KEGG   Cronobacter sakazakii ATCC 29544: CSK29544_04215
Entry
CSK29544_04215    CDS       T03903                                 
Name
(GenBank) taurine dioxygenase TauD
  KO
K03119  taurine dioxygenase [EC:1.14.11.17]
Organism
csj  Cronobacter sakazakii ATCC 29544
Pathway
csj00430  Taurine and hypotaurine metabolism
csj00920  Sulfur metabolism
Brite
KEGG Orthology (KO) [BR:csj00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    CSK29544_04215
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    CSK29544_04215
Enzymes [BR:csj01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.17  taurine dioxygenase
     CSK29544_04215
SSDB
Motif
Pfam: TauD
Other DBs
NCBI-ProteinID: AKE97156
UniProt: A0A7V7R9S8
LinkDB
Position
complement(4368954..4369805)
AA seq 283 aa
MSERITITPLGPYIGALVSDINLARPLSDSQFEQLYHALIRHQVLFVRDQPITPQQQRAL
AMRFGDLHIHPVYPHAEGVEEIIVLDTHNDNPPDNDNWHTDVTFIDTPPAGAILAAKALP
PTGGDTLWTSGIAAFEALSAPFQQLLSGLRAEHDFRKSFPEWKHTKTEEDHQRWLTAVEK
NPPLLHPVVRTHPVSGKQALFVNEGFTTRIVDVSPKESDALLNFLFAHITKPEFQVRWRW
QENDVALWDNRVTQHYANADYLPARRVMHRATILGDKPFYRAG
NT seq 852 nt   +upstreamnt  +downstreamnt
atgagcgagcgcataaccatcacgccgctggggccgtatatcggtgccctggtctccgat
atcaacctggcgcgaccgctgagcgacagccagttcgagcagctgtatcacgcgttgata
cgccatcaggtgctgttcgtgcgcgatcagcccatcacgccgcagcagcagcgggcgctg
gcgatgcgttttggcgatctgcacattcacccggtctacccgcatgcggaaggcgtggag
gagattatcgtgctggatacgcataacgataacccgccggataacgataactggcacacc
gacgtgacctttatcgacacgccgcctgcgggcgcgatcctggcggcgaaagcgctgccg
cccaccggcggcgatacgctctggacgagcggcatcgcggcgttcgaggcgctctccgcc
ccgtttcagcagttgttaagcggcctgcgcgccgagcacgatttccggaagtcgttcccg
gagtggaagcacacgaaaacggaggaagatcaccagcgctggctcacggcggtggagaaa
aacccgccgctgctgcacccggtggtgcgcacgcatccggtgagcggtaaacaggcgctg
ttcgtcaatgaaggcttcacgacgcgcattgtcgatgtgtcgcccaaagagagcgacgcg
ctgctgaattttcttttcgcgcatattacaaaaccggagttccaggtgcgctggcgctgg
caagaaaatgacgtggcgctgtgggataaccgcgtgacgcagcactacgccaacgccgat
tatctccccgcccggcgcgtgatgcaccgcgcgacgatccttggcgataagcccttttat
cgggccggttaa

DBGET integrated database retrieval system