Cronobacter sakazakii ES15: ES15_2695 Help Entry ES15_2695         CDS       T02119                                  Symbol ybgT Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism csk  Cronobacter sakazakii ES15 Pathway csk00190   Oxidative phosphorylation csk01100   Metabolic pathways csk02020   Two-component system Module csk_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:csk00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     ES15_2695 (ybgT)  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     ES15_2695 (ybgT) Enzymes [BR:csk01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      ES15_2695 (ybgT) SSDB OrthologParalogGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  AFK00269 LinkDB All DBs Position complement(2889600..2889713) Genome browser AA seq 37 aa AA seqDB search MWYFAWILGTLLACAFGIITALALEHVEATKAGKVES NT seq 114 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcgcctggattctcggaacgcttctggcctgtgctttcgggatcattacc gcgctggcgctggaacacgttgaagcgaccaaagccggtaaagtcgagtcgtga

DBGET integrated database retrieval system