Coccomyxa subellipsoidea: COCSUDRAFT_25603 Help Entry COCSUDRAFT_25603  CDS       T02914                                  Name (RefSeq) hypothetical protein   KO K10418   dynein light chain LC8-type Organism csl  Coccomyxa subellipsoidea Pathway csl04145   Phagocytosis csl04517   IgSF CAM signaling csl04814   Motor proteins Brite KEGG Orthology (KO) [BR:csl00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     COCSUDRAFT_25603  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     COCSUDRAFT_25603   09142 Cell motility    04814 Motor proteins     COCSUDRAFT_25603  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:csl03037]     COCSUDRAFT_25603    04812 Cytoskeleton proteins [BR:csl04812]     COCSUDRAFT_25603 Cilium and associated proteins [BR:csl03037]  Motile cilia and associated proteins   Dynein arm    COCSUDRAFT_25603 Cytoskeleton proteins [BR:csl04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      COCSUDRAFT_25603 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light DUF1672 Motif Other DBs NCBI-GeneID:  17037992 NCBI-ProteinID:  XP_005644562 JGI:  25603 UniProt:  I0YNP9 LinkDB All DBs AA seq 89 aa AA seqDB search MEEKRVVIKCVDMREDLQSEAIQCASEAMELYTVEKDIAATIKKHFDEKFKPTWHCIVGR NFGSYVTHESSHFIYFYIGPQAILLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atggaggagaaacgtgtggtcatcaagtgtgtggacatgcgcgaagatcttcagagcgag gcgattcaatgtgcatctgaggccatggaactctacactgttgaaaaggacatcgctgcc acaatcaagaagcactttgacgagaaattcaagccaacatggcactgcatcgtcggcaga aacttcgggtcgtatgtcactcatgaaagcagccacttcatctatttttacataggtcct caagctatcctgctgttcaagtcaggataa

DBGET integrated database retrieval system