Coccomyxa subellipsoidea: COCSUDRAFT_28844 Help Entry COCSUDRAFT_28844  CDS       T02914                                  Name (RefSeq) Sm-E protein   KO K12624   U6 snRNA-associated Sm-like protein LSm5 Organism csl  Coccomyxa subellipsoidea Pathway csl03018   RNA degradation csl03040   Spliceosome Brite KEGG Orthology (KO) [BR:csl00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     COCSUDRAFT_28844   09123 Folding, sorting and degradation    03018 RNA degradation     COCSUDRAFT_28844  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:csl03019]     COCSUDRAFT_28844    03041 Spliceosome [BR:csl03041]     COCSUDRAFT_28844 Messenger RNA biogenesis [BR:csl03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      COCSUDRAFT_28844   mRNA degradation factors    5'-3' decay     Lsm complex      COCSUDRAFT_28844 Spliceosome [BR:csl03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     COCSUDRAFT_28844 SSDB OrthologParalogGFIT Motif Pfam:  LSM Motif Other DBs NCBI-GeneID:  17041426 NCBI-ProteinID:  XP_005647978 JGI:  28844 UniProt:  I0YYG5 LinkDB All DBs AA seq 95 aa AA seqDB search MIAPKKASFQGNPSHLMPSELIDKCINSKIWVIMKGDKELQGTLRGFDVFVNMVLEDVEE YEMTAEGLRVTHMDQILLNGNNIAVLVPGGKPEES NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgatagcccccaaaaaggcatccttccaaggaaacccctcgcacttgatgccctccgag ctcattgacaagtgcataaactccaagatctgggtcatcatgaagggagacaaggagcta caggggacgctgcgtggctttgatgtctttgtcaacatggtgctggaggatgtggaggag tatgagatgacagctgagggcttgagagtgacgcacatggaccagatcctgctcaacggc aacaacattgccgtgctagtgccaggaggcaagccagaggagtcatga

DBGET integrated database retrieval system