Coccomyxa subellipsoidea: COCSUDRAFT_55823 Help Entry COCSUDRAFT_55823  CDS       T02914                                  Name (RefSeq) ubiquitin-like protein   KO K13113   ubiquitin-like protein 5 Organism csl  Coccomyxa subellipsoidea Brite KEGG Orthology (KO) [BR:csl00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:csl03041]     COCSUDRAFT_55823   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:csl04052]     COCSUDRAFT_55823 Spliceosome [BR:csl03041]  Complex B   Other components    Complex B specific factors     COCSUDRAFT_55823 Cytokines and neuropeptides [BR:csl04052]  Neuropeptides   Unclassified    COCSUDRAFT_55823 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Rad60-SLD OTU1_UBXL Ubiquitin_4 Motif Other DBs NCBI-GeneID:  17040112 NCBI-ProteinID:  XP_005646670 JGI:  55823 UniProt:  I0YUQ7 LinkDB All DBs AA seq 73 aa AA seqDB search MIEVILNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRPEKIRIQKWYNIYKDHITLADY EIHDGMGLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgattgaagtgattttgaacgatcgcttgggaaagaaggtccgcgtcaagtgcaacgag gacgataccattggagacctgaagaagttggtggctgcacaaaccggcactcgccccgag aaaatccgcatccagaagtggtacaatatctacaaggaccacatcacgctggcagactac gagatccacgacggcatgggccttgagctgtactacaattag

DBGET integrated database retrieval system