Coccomyxa subellipsoidea: COCSUDRAFT_9605 Help Entry COCSUDRAFT_9605   CDS       T02914                                  Name (RefSeq) dynein light chain 9   KO K10420   dynein light chain Tctex-type 1/3 Organism csl  Coccomyxa subellipsoidea Pathway csl04814   Motor proteins Brite KEGG Orthology (KO) [BR:csl00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     COCSUDRAFT_9605  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:csl03037]     COCSUDRAFT_9605    04812 Cytoskeleton proteins [BR:csl04812]     COCSUDRAFT_9605 Cilium and associated proteins [BR:csl03037]  Motile cilia and associated proteins   Dynein arm    COCSUDRAFT_9605 Cytoskeleton proteins [BR:csl04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      COCSUDRAFT_9605 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  17041528 NCBI-ProteinID:  XP_005648080 JGI:  9605 UniProt:  I0YYR7 LinkDB All DBs AA seq 102 aa AA seqDB search LDDAEVDALIRETIVLTLGSDSQFDHNNMNQWTNEIIEGCLKRLAGLGKPFKYVVPGDLL QVGAGLHSACTARWNDKTDGKLTVQWENRTVLVLATAYWLAV NT seq 306 nt NT seq  +upstreamnt  +downstreamnt ctggatgacgccgaggtggatgctctgatcagggaaacgatcgtgttgacgctggggagt gacagccaatttgatcacaacaacatgaatcagtggacaaacgaaattattgaagggtgc ttgaagaggttagcgggccttggcaagccttttaaatatgtggtacctggtgaccttttg caggttggagctgggcttcattctgcctgcacagcacgttggaacgacaaaacagatggg aagctgacagtgcagtgggaaaataggacagtcttggtgcttgccacagcatactggctg gcagtg

DBGET integrated database retrieval system