Coccomyxa subellipsoidea: COCSUDRAFT_9668 Help Entry COCSUDRAFT_9668   CDS       T02914                                  Name (RefSeq) hypothetical protein   KO K11254   histone H4 Organism csl  Coccomyxa subellipsoidea Brite KEGG Orthology (KO) [BR:csl00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:csl03036]     COCSUDRAFT_9668 Chromosome and associated proteins [BR:csl03036]  Eukaryotic type   Nucleosome assembly factors    Histones     COCSUDRAFT_9668 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-T_C CENP-S CBFD_NFYB_HMF TAF Bromo_TP Motif Other DBs NCBI-GeneID:  17039606 NCBI-ProteinID:  XP_005646166 JGI:  9668 UniProt:  I0YTA3 LinkDB All DBs AA seq 54 aa AA seqDB search GVKRMSSDFPFEAMKALREFLRDILRDMIIITEHGRRHTATVMDVLLALKRKGR NT seq 162 nt NT seq  +upstreamnt  +downstreamnt ggtgtcaagaggatgagctctgatttcccttttgaagcaatgaaggctctcagagaattc ttgcgagacatcctccgagacatgatcatcatcacagagcatggaaggcgccacacagcc actgtgatggatgtcctgctggcactgaagcgaaagggcagg

DBGET integrated database retrieval system