Campylobacter subantarcticus LMG 24374: CSUB8521_1497 Help Entry CSUB8521_1497     CDS       T03571                                  Symbol acpP4 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism csm  Campylobacter subantarcticus LMG 24374 Pathway csm01100   Metabolic pathways csm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:csm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CSUB8521_1497 (acpP4)    00074 Mycolic acid biosynthesis     CSUB8521_1497 (acpP4)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CSUB8521_1497 (acpP4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AJC91318 UniProt:  A0A0A8HB10 LinkDB All DBs Position 1490029..1490247 Genome browser AA seq 72 aa AA seqDB search MTKEQLLEAISEAMHMDETLKEDMILDDIDEWDSLAFVSIMVLFKNSLGKQISGDDLKKC EKVSDLLALAKL NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgactaaagaacaattattagaagctattagtgaggctatgcatatggatgaaacacta aaagaagatatgatcttagatgatattgatgaatgggatagcttagcttttgtatctatc atggtgcttttcaaaaattcacttggcaagcaaattagtggtgatgatcttaaaaaatgt gaaaaagtaagtgatcttttagctttagcaaaattataa

DBGET integrated database retrieval system