Ceratosolen solmsi marchali (fig wasp): 105359681 Help Entry 105359681         CDS       T06056                                  Name (RefSeq) thioredoxin-2-like   KO K03671   thioredoxin Organism csol  Ceratosolen solmsi marchali (fig wasp) Brite KEGG Orthology (KO) [BR:csol00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:csol03110]     105359681 Chaperones and folding catalysts [BR:csol03110]  Protein folding catalysts   Protein disulfide isomerase    105359681 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin AhpC-TSA Thioredoxin_8 Redoxin Thioredoxin_7 Thioredoxin_2 Motif Other DBs NCBI-GeneID:  105359681 NCBI-ProteinID:  XP_011494629 UniProt:  A0AAJ6VLP4 LinkDB All DBs Position Unknown AA seq 55 aa AA seqDB search MVIYVATSADLKARLNDSQYKIVVVDFFATWCAPCRMIAPQFETLAEVCSYFLYY NT seq 168 nt NT seq  +upstreamnt  +downstreamnt atggtgatatatgtcgcaacatcggctgacctgaaagccaggctgaatgattcgcagtat aaaattgttgttgttgacttttttgcaacatggtgtgcaccgtgtagaatgatagcaccg cagtttgaaacccttgccgaggtatgctcatatttcttatactactag

DBGET integrated database retrieval system