Ceratosolen solmsi marchali (fig wasp): 105361392 Help Entry 105361392         CDS       T06056                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism csol  Ceratosolen solmsi marchali (fig wasp) Pathway csol04013   MAPK signaling pathway - fly csol04145   Phagosome csol04148   Efferocytosis csol04310   Wnt signaling pathway csol04620   Toll-like receptor signaling pathway csol05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:csol00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     105361392    04310 Wnt signaling pathway     105361392  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     105361392    04148 Efferocytosis     105361392  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105361392  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     105361392  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:csol04131]     105361392   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csol04147]     105361392    04031 GTP-binding proteins [BR:csol04031]     105361392 Membrane trafficking [BR:csol04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     105361392  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     105361392   Macropinocytosis    Ras GTPases     105361392  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     105361392 Exosome [BR:csol04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105361392   Exosomal proteins of other body fluids (saliva and urine)    105361392   Exosomal proteins of colorectal cancer cells    105361392   Exosomal proteins of bladder cancer cells    105361392 GTP-binding proteins [BR:csol04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     105361392 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  105361392 NCBI-ProteinID:  XP_011496855 UniProt:  A0AAJ6YF19 LinkDB All DBs Position Unknown AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPTTPIILVGTKLDLR EDKETIERLKDKKLAPITYPQGLTMAKEIGSVKYLECSALTQKGLKTVFDEAIRAVLCPA LQVKPKRRCCIL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaggcgatcaagtgtgtcgttgtaggtgacggagctgttggtaaaacatgtttatta attagttatactacaaatgcatttcctggggaatatataccaacagtttttgataattat tctgctaatgttatggttgatggaaaaccaattaacttgggcctttgggatacagctggt caagaagattatgataggctacgaccattatcatatccacagactgatgtatttctcatt tgcttttcacttgtaaatccagcaagttttgaaaatgtaagagctaaatggtatccagaa gtacgtcatcattgcccaacaactcccattattttggttggaactaagcttgacttacgt gaagataaagaaaccattgagcgattaaaggataaaaaacttgctcctattacttatcct cagggtcttacaatggcaaaagaaattggatcagtgaaatatttagaatgctctgcttta acacaaaaaggacttaaaacagtgtttgatgaagcaatccgtgcagttctttgtcctgct ctgcaggtaaagccaaaacgtagatgttgcattctataa

DBGET integrated database retrieval system