Ceratosolen solmsi marchali (fig wasp): 105361392 Help Entry 105361392         CDS       T06056                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism csol  Ceratosolen solmsi marchali (fig wasp) Pathway csol04013   MAPK signaling pathway - fly csol04145   Phagosome csol04148   Efferocytosis csol04310   Wnt signaling pathway csol04517   IgSF CAM signaling csol04518   Integrin signaling csol04620   Toll-like receptor signaling pathway csol05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:csol00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     105361392    04310 Wnt signaling pathway     105361392   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     105361392    04518 Integrin signaling     105361392  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     105361392    04148 Efferocytosis     105361392  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105361392  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     105361392  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:csol04131]     105361392   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csol04147]     105361392    04031 GTP-binding proteins [BR:csol04031]     105361392 Membrane trafficking [BR:csol04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     105361392  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     105361392   Macropinocytosis    Ras GTPases     105361392  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     105361392 Exosome [BR:csol04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105361392   Exosomal proteins of other body fluids (saliva and urine)    105361392   Exosomal proteins of colorectal cancer cells    105361392   Exosomal proteins of bladder cancer cells    105361392 GTP-binding proteins [BR:csol04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     105361392 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  105361392 NCBI-ProteinID:  XP_011496855 UniProt:  A0AAJ6YF19 LinkDB All DBs Position Unknown AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPTTPIILVGTKLDLR EDKETIERLKDKKLAPITYPQGLTMAKEIGSVKYLECSALTQKGLKTVFDEAIRAVLCPA LQVKPKRRCCIL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaggcgatcaagtgtgtcgttgtaggtgacggagctgttggtaaaacatgtttatta attagttatactacaaatgcatttcctggggaatatataccaacagtttttgataattat tctgctaatgttatggttgatggaaaaccaattaacttgggcctttgggatacagctggt caagaagattatgataggctacgaccattatcatatccacagactgatgtatttctcatt tgcttttcacttgtaaatccagcaagttttgaaaatgtaagagctaaatggtatccagaa gtacgtcatcattgcccaacaactcccattattttggttggaactaagcttgacttacgt gaagataaagaaaccattgagcgattaaaggataaaaaacttgctcctattacttatcct cagggtcttacaatggcaaaagaaattggatcagtgaaatatttagaatgctctgcttta acacaaaaaggacttaaaacagtgtttgatgaagcaatccgtgcagttctttgtcctgct ctgcaggtaaagccaaaacgtagatgttgcattctataa

DBGET integrated database retrieval system