Ceratosolen solmsi marchali (fig wasp): 105365464 Help Entry 105365464         CDS       T06056                                  Name (RefSeq) insulin-like   KO K05459   insulin-like growth factor 1 Organism csol  Ceratosolen solmsi marchali (fig wasp) Pathway csol04068   FoxO signaling pathway csol04081   Hormone signaling csol04150   mTOR signaling pathway csol04213   Longevity regulating pathway - multiple species Brite KEGG Orthology (KO) [BR:csol00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     105365464    04150 mTOR signaling pathway     105365464   09133 Signaling molecules and interaction    04081 Hormone signaling     105365464  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     105365464  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:csol04052]     105365464 Cytokines and neuropeptides [BR:csol04052]  Cytokines   Growth factors (RTK binding)    105365464 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  105365464 NCBI-ProteinID:  XP_011501937 UniProt:  A0AAJ6YPL7 LinkDB All DBs Position Unknown AA seq 115 aa AA seqDB search MSRWLCLKMLLLGLLLLGPLLLALTEAGPVLTGAGVGAGHRRYYRRAVRLCSRSLSDALY LLCKDRGYNEPFSSSGETEVRHTTGPGLVEECCYNACSIEQMEQYCKPRGKQAQP NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atgagccgctggctgtgcctgaagatgctcctgctggggcttctgctactgggcccgctg ctgctcgcgcttacggaggctggcccagtactgaccggggcaggggtcggggccggacac cggcgctattaccggcgcgccgtccgcctctgctcgcgcagtcttagcgatgcgctctac ctgctgtgcaaggatcggggctacaacgagcccttcagcagtagcggcgagacggaggtg cgccacacgacggggccgggcctcgtcgaggagtgctgctacaacgcctgcagcatcgag cagatggagcagtactgcaagccaaggggcaagcaggcgcagccctga

DBGET integrated database retrieval system