Campylobacter sputorum: CSF_1353 Help Entry CSF_1353          CDS       T04992                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cspf  Campylobacter sputorum Pathway cspf01100   Metabolic pathways cspf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cspf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CSF_1353 (acpP)    00074 Mycolic acid biosynthesis     CSF_1353 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CSF_1353 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N DUF3219 Motif Other DBs NCBI-ProteinID:  ASM37202 LinkDB All DBs Position complement(1343495..1343728) Genome browser AA seq 77 aa AA seqDB search MAVFEDVRDVVVEQLSVSPESVKLESKIIEDLGADSLDVVELVMALEEKFDVSIPDSDAE KLLSIQDVVTYIENLNK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcagtatttgaagatgtaagagatgtggttgtagagcaacttagcgttagtcctgaa agcgtaaagcttgagtctaaaataatagaagatttaggcgctgattctctagatgttgtt gaattggtaatggctttagaggagaaatttgatgtttctatccctgatagtgatgctgaa aaattacttagcattcaagatgttgtaacatatatagaaaatctaaataaatag

DBGET integrated database retrieval system