Crateriforma spongiae: ACLV6H_22015 Help Entry ACLV6H_22015      CDS       T11503                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cspn  Crateriforma spongiae Pathway cspn00998   Biosynthesis of various antibiotics cspn01100   Metabolic pathways cspn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cspn00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ACLV6H_22015    00074 Mycolic acid biosynthesis     ACLV6H_22015   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ACLV6H_22015 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  XNP80478 LinkDB All DBs Position complement(5793238..5793489) Genome browser AA seq 83 aa AA seqDB search MTPEEIRSEILDILDDISPDEDLDSLDDDKPFREQLELDSMDFLDIVMELRKRHRVQIPE EDYGNLASMQSTVTYLEPKMKDL NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgacccctgaagaaattcgatccgagattctggacatccttgacgatatttcgcccgac gaggacctggacagcctggacgacgacaagccgtttcgcgaacagctggaactggacagc atggactttctggacatcgtgatggagctgcgcaagcgccatcgtgttcagattcccgag gaagattacggcaatttggccagcatgcagtcgacggtgacttacctggaaccgaagatg aaggacctgtag

DBGET integrated database retrieval system