Caminicella sporogenes: QNI18_10725 Help Entry QNI18_10725       CDS       T09087                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism cspo  Caminicella sporogenes Pathway cspo00020   Citrate cycle (TCA cycle) cspo00720   Other carbon fixation pathways cspo01100   Metabolic pathways cspo01110   Biosynthesis of secondary metabolites cspo01120   Microbial metabolism in diverse environments cspo01200   Carbon metabolism cspo01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:cspo00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     QNI18_10725   09102 Energy metabolism    00720 Other carbon fixation pathways     QNI18_10725 Enzymes [BR:cspo01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      QNI18_10725 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_6 Fer4_10 Fer4_2 Fer4_9 Fer4_21 Fer4_16 Fer4_4 Fer4_8 Fer4_17 Fer4_3 Fer4_15 Fer4_22 Fer4_13 Fer4_ETF_QO DUF4548 Motif Other DBs NCBI-ProteinID:  WIF94722 LinkDB All DBs Position complement(2143978..2144196) Genome browser AA seq 72 aa AA seqDB search MNQNKNDIILKVERELCKGCRICVEFCPKDVLAIAEDNKIIIKNIENCIKCGLCEMRCPD YAIYLGGIDDEQ NT seq 219 nt NT seq  +upstreamnt  +downstreamnt ttgaatcagaataaaaatgatattattttgaaggtagaaagagaattatgtaaaggctgt agaatatgtgttgaattttgtccaaaagacgttttagccatagccgaagataataagata attattaaaaatattgaaaattgtataaaatgtggtttgtgtgagatgagatgtcctgat tatgctatttatttaggaggtattgatgatgagcaataa

DBGET integrated database retrieval system