Capnocytophaga sputigena: CGC55_09145 Help Entry CGC55_09145       CDS       T05393                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cspu  Capnocytophaga sputigena Pathway cspu01100   Metabolic pathways cspu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cspu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CGC55_09145    00074 Mycolic acid biosynthesis     CGC55_09145   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CGC55_09145 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  ATA84660 UniProt:  A0A250FHT4 LinkDB All DBs Position 1973562..1973810 Genome browser AA seq 82 aa AA seqDB search MNRQEIIDLTTRIFVDEFEVDGSVIAPEANFRDSLGLDSLDYVDLVVMIEQEFGVKLVEA DFKPIVTFNDFYTTLENKVNAH NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgaacagacaagaaataatagaccttactacccgtatttttgtagatgaatttgaagta gatggcagtgtgattgcccctgaggctaacttccgcgattccttaggattagacagcctc gactacgtagatttggtggtgatgattgaacaagaattcggtgtgaaattagtagaagcc gattttaaacctatcgtaaccttcaatgacttttatactaccttagaaaataaagtgaat gcacactaa

DBGET integrated database retrieval system