Comamonas squillarum: N4T19_04915
Help
Entry
N4T19_04915 CDS
T10846
Name
(GenBank) SulP family inorganic anion transporter
KO
K03321
sulfate permease, SulP family
Organism
csqu Comamonas squillarum
Brite
KEGG Orthology (KO) [BR:
csqu00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
csqu02000
]
N4T19_04915
Transporters [BR:
csqu02000
]
Other transporters
Electrochemical potential-driven transporters [TC:
2
]
N4T19_04915
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Sulfate_transp
STAS
STAS_2
MASE9
Motif
Other DBs
NCBI-ProteinID:
UXC19465
UniProt:
A0ABY5ZZM3
LinkDB
All DBs
Position
1052770..1054464
Genome browser
AA seq
564 aa
AA seq
DB search
MQPSLIYRIFPFLRWPKPTKQLLRGEFMAGMTVGLMLVPQGVAYAHLAGMPLITGIYASI
IPAAVAILFSPSPRLGVGPTALSALLIGASLTGMAEPGSAQWVILAAWMAIMAGLVQLSL
GLVRAGWLLNLVTSPVLAGFTQAAALLILASQLPSLLGMRSDWATVWDNPSLGLFDWRSI
LLGLASIAILVVGKKWRPAFPSAVFVIGCTGLISWATDFADKGGAVVGHLPTGLPQLVWP
GMLDWSQFGLLVMPVLVISLVSALETASSAQVEHQQAGTRWDSSQELVAQGLSKMSAGLF
GSFATSASFSRSAVNLLAGAKTGYANVFSILLVVAVVLWFIPALYHVPQAALAAIVMTAV
ANLVKPRVLVYLFKISRIEGSIAVATFGVTLLTAPRIYWGVLSGILLSSCYFLYNRLHPR
IVEVGLHPDGSLRDRHLWQLPPLAPDLLALRMDSELDFASAAALEERAANVWTQHTHYRQ
LALLAQPMNQIDITGVEAFVRLERMAAKRGGMLHIVGMKLPVEARLKRAGLLQDNPHLRM
YRTDAEFLQAMRRAHSDDGIEYSI
NT seq
1695 nt
NT seq
+upstream
nt +downstream
nt
atgcagccctccctgatttaccgcattttccccttcctgcgctggcccaagccgaccaaa
caactcttgcgcggtgaattcatggcggggatgacggtagggctgatgctggtgccccag
ggcgtggcttatgcgcatctggctggcatgccgctgatcaccggcatctatgcctcgatc
attcccgcagccgtggccatcctctttagcccctcgcctcggctgggcgtcgggcccacg
gcgctgagcgccttgctcattggcgcctcgctcaccggcatggccgagcccggctcggcc
cagtgggtcattctggcagcgtggatggccatcatggccggcctggtccagctgagcttg
ggcctggtgcgcgccggctggctgctgaacctggtgacctcgcccgtgctggccggcttc
acgcaggccgctgcgctgctcattctggcctcgcagctgcctagtttgctgggcatgcgc
agcgactgggccacggtctgggacaacccctcgctgggccttttcgactggcgctccatc
ctgctgggcctggcgagcatcgccatcctggtggtgggcaaaaagtggcgccccgccttt
ccgtctgctgtttttgtcatcggctgcaccgggcttatcagttgggccaccgactttgcc
gacaagggcggcgccgtggtcggccacttgcccacgggcctgccgcagctggtctggccg
ggcatgctggactggtcgcagtttggcctgctcgtcatgccggtgctggtgatctcgctg
gtcagtgcgctggagaccgcctccagcgcccaggtcgagcaccaacaggcgggcacgcgc
tgggacagcagccaggagctggtcgcgcaaggcctgtccaagatgagtgccggcctgttt
ggcagctttgccaccagtgcctcgttctcgcgctcggccgtcaatctgctggccggcgcc
aagacgggctacgccaatgtcttttccatcttgctggtcgtggccgtcgtgctgtggttc
atcccggcgctctaccatgtgccgcaggccgcgctcgctgccatcgtgatgacggctgtc
gccaacctcgtcaagccccgcgtcctggtctacctgttcaagatctcacgcatcgaaggc
agcattgcagtggccacctttggcgtcaccttgctgacggcgccacgcatctactggggc
gtgctgtcgggcattttgctcagctcctgctactttctctacaaccgcctgcacccgcgc
attgttgaggtaggcctgcaccccgatggcagcctgcgcgaccgccatctgtggcaactg
ccccccttggccccggatctgctggccctgcgcatggattcggagctggactttgcatcg
gctgccgcgctggaggagcgcgccgccaatgtctggacccagcacacgcactaccggcag
ctcgccctgttggcccagccgatgaaccagatcgacatcaccggcgtcgaagcctttgtg
cggctcgagcgcatggctgccaagcgcggcggcatgctgcacatcgttggcatgaagctg
cccgttgaagcccgcctcaaacgcgccggcctcttgcaggacaacccgcatctgcgcatg
taccgcaccgatgccgagtttctgcaggcgatgcgccgtgcgcacagcgatgacggcatc
gagtattccatctag
DBGET
integrated database retrieval system