Comamonas squillarum: N4T19_06760
Help
Entry
N4T19_06760 CDS
T10846
Symbol
phoB
Name
(GenBank) phosphate regulon transcriptional regulator PhoB
KO
K07657
two-component system, OmpR family, phosphate regulon response regulator PhoB
Organism
csqu Comamonas squillarum
Pathway
csqu02020
Two-component system
Brite
KEGG Orthology (KO) [BR:
csqu00001
]
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
N4T19_06760 (phoB)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02022 Two-component system [BR:
csqu02022
]
N4T19_06760 (phoB)
Two-component system [BR:
csqu02022
]
OmpR family
PhoR-PhoB (phosphate starvation response)
N4T19_06760 (phoB)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Trans_reg_C
Response_reg
GerE
HTH_11
Motif
Other DBs
NCBI-ProteinID:
UXC19802
UniProt:
A0ABY6A477
LinkDB
All DBs
Position
complement(1453085..1453792)
Genome browser
AA seq
235 aa
AA seq
DB search
MKKLPRVLIVEDEPAIAELIAVNLRHNGCLPIWAEDGDAAQRELDAVLPDVILLDWMLPG
QSGLSLARKWRADARVKGIPIIMLTARGDEPDKIAGLDAGADDYITKPFSTQELLARIRA
VLRRRIPEQVNDSVTIGELVLDAATHRVTFQGELLKLGPTEFKLLHFLMKHAERVHSRSQ
LLDKVWGDHVFIEERTVDVHVKRLREALGAANVMVETVRGAGYRITGQPQALQRA
NT seq
708 nt
NT seq
+upstream
nt +downstream
nt
atgaaaaaactgccacgcgtactcattgtcgaagacgagcccgcgattgccgagctgatc
gcggtgaacctgcgacacaacggctgcctgccgatctgggcagaggatggtgatgccgca
cagcgcgaattggacgcggtgctgcccgatgtgatcttgctggactggatgctgccgggc
caaagcggcctgtcgctggcgcgcaaatggcgtgcggatgcccgcgtcaagggcattccc
atcatcatgctgaccgcccgcggcgacgagcctgacaagatcgccgggctcgatgccggt
gccgatgactacatcaccaagcctttttccacgcaggaattgctggcccgcatccgtgcg
gtgctgcgccggcgcattcccgagcaggtcaacgacagtgtgacgattggtgagctggtg
ctggacgcggccacgcaccgtgtcacgttccagggtgagctgctcaagctcggccccacc
gagttcaagctgctgcactttttgatgaagcatgccgagcgtgtgcactcgcgctcgcag
ctgctcgacaaggtctggggcgaccatgtgttcatcgaggagcgcaccgtggacgtccat
gtcaagcgtctgcgcgaggccttgggcgctgccaatgtgatggtggagaccgtacgtggg
gccggctaccgcatcaccggccagccccaggcgctgcagcgcgcttag
DBGET
integrated database retrieval system