Comamonas squillarum: N4T19_10720 Help Entry N4T19_10720       CDS       T10846                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism csqu  Comamonas squillarum Pathway csqu01100   Metabolic pathways csqu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:csqu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     N4T19_10720 (acpP)    00074 Mycolic acid biosynthesis     N4T19_10720 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     N4T19_10720 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF7127 Phage_terminase Motif Other DBs NCBI-ProteinID:  UXC20539 UniProt:  A0ABY6A3J3 LinkDB All DBs Position complement(2297187..2297426) Genome browser AA seq 79 aa AA seqDB search MSDIEARVKKIIAEQLGVEESQVTNEKAFVADLGADSLDTVELVMALEDEFEIEIPDEDA EKITTVQNAIDYANSHQKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgaagcacgtgtcaagaaaatcatcgccgagcaactcggcgtggaagag tctcaagtaacgaacgaaaaggcttttgtagccgacctgggcgctgactcgctggacacc gtggaactggtgatggctttggaagatgagttcgagatcgagatccctgacgaagacgca gagaagatcacgacggtgcagaacgccatcgactacgccaacagccaccaaaaggcttaa

DBGET integrated database retrieval system