Conchiformibius steedae: H3L98_09910 Help Entry H3L98_09910       CDS       T06730                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cste  Conchiformibius steedae Pathway cste01100   Metabolic pathways cste01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cste00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     H3L98_09910    00074 Mycolic acid biosynthesis     H3L98_09910   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     H3L98_09910 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QMT33381 LinkDB All DBs Position 1937088..1937360 Genome browser AA seq 90 aa AA seqDB search MSSDLKQQLKQLIVSETEKDHLNPQEIDDNEPLFGERSRVGLDSLDALQISIALQARYGV RLNGDRMVRKHMMTVGALADFILSEQKHEP NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgtcttccgacctcaagcagcagctcaagcaactgattgttagcgaaaccgaaaaagac catttaaatccacaagaaatagacgacaacgaacctttattcggcgaacgcagccgtgtc gggttggattccttggacgcgctgcaaatcagcattgccctgcaagcgcgttacggcgtg cgtttaaacggcgaccgcatggtacgcaaacacatgatgacggtgggcgcgttggcggat tttatcctttctgaacaaaaacatgaaccgtaa

DBGET integrated database retrieval system