Colius striatus (speckled mousebird): 104549515 Help Entry 104549515         CDS       T08355                                  Symbol APITD1 Name (RefSeq) centromere protein S   KO K11511   centromere protein S Organism csti  Colius striatus (speckled mousebird) Pathway csti03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:csti00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     104549515 (APITD1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:csti03036]     104549515 (APITD1)    03400 DNA repair and recombination proteins [BR:csti03400]     104549515 (APITD1) Chromosome and associated proteins [BR:csti03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      104549515 (APITD1) DNA repair and recombination proteins [BR:csti03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      104549515 (APITD1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-S CENP-T_C Histone TFIID-31kDa Bromo_TP UPF0122 TAF MAP17 Motif Other DBs NCBI-GeneID:  104549515 NCBI-ProteinID:  XP_010203328 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search RLKAAVHYTVGCLCQEVAEDKDMQFSKQAIAAVSEITFRQCETFAKDLEMFARHAKRSTI TTDDVKLLARRSNSLLNYITQKSEEITSNNMEQKEKKKKKSSAAKGGKTSEEQEAAVTES EDPNMS NT seq 381 nt NT seq  +upstreamnt  +downstreamnt aggctgaaggctgcggttcactacacggttggctgcttgtgccaggaggttgcagaagac aaagacatgcagttcagcaaacaagccattgccgctgtttcagagatcaccttcaggcag tgtgagacatttgcaaaagacctcgaaatgtttgcaaggcatgcaaaaagaagcacaatc actacagatgatgtgaagcttctggccagaaggagcaattctttgctgaattacatcacc cagaagagtgaagagataacatccaataacatggagcaaaaggagaagaagaaaaagaag tccagtgcagctaagggagggaaaacctctgaggagcaagaagcagctgtgactgaaagt gaagatcccaacatgtcatga

DBGET integrated database retrieval system