Colius striatus (speckled mousebird): 104550228 Help Entry 104550228         CDS       T08355                                  Name (RefSeq) glutathione S-transferase-like   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism csti  Colius striatus (speckled mousebird) Pathway csti00480   Glutathione metabolism csti00980   Metabolism of xenobiotics by cytochrome P450 csti00982   Drug metabolism - cytochrome P450 csti00983   Drug metabolism - other enzymes csti01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:csti00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     104550228   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     104550228    00982 Drug metabolism - cytochrome P450     104550228    00983 Drug metabolism - other enzymes     104550228  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:csti02000]     104550228 Enzymes [BR:csti01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      104550228 Transporters [BR:csti02000]  Other transporters   Pores ion channels [TC:1]    104550228 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GST_C_3 GST_C DUF3870 Arc1p_N_like RRM_3 Motif Other DBs NCBI-GeneID:  104550228 NCBI-ProteinID:  XP_010207292 LinkDB All DBs Position Unknown AA seq 121 aa AA seqDB search LYGKDLKERALIDMYVEAIIDLNELFIMHEILSGDKKKEQFANIVDKATNRYFPVFEKVL KDHGQDFLVGNQLSRADVQLLEAILMVEEGKPDVLAKFPLLQSFKARISNIPTIKKFLQP G NT seq 363 nt NT seq  +upstreamnt  +downstreamnt ctctatgggaaggacctgaaggaaagagccctaattgatatgtacgtggaagcaataata gatttgaatgagttattcataatgcatgagatcctctcgggagataaaaagaaagaacag tttgctaatattgtggacaaggccacaaacagatacttcccagtctttgagaaggttctg aaagaccatggacaagacttccttgttggcaaccagctgagcagggcagacgtgcagtta cttgaagccattttaatggtagaagaggggaagcctgatgtacttgccaaatttcctctg ctgcagagttttaaagcaagaataagcaatatccccacaataaagaaattcctgcagcct ggc

DBGET integrated database retrieval system