Colius striatus (speckled mousebird): 104551203 Help Entry 104551203         CDS       T08355                                  Name (RefSeq) ras-related protein Rab-8A   KO K07901   Ras-related protein Rab-8A Organism csti  Colius striatus (speckled mousebird) Pathway csti04140   Autophagy - animal csti04144   Endocytosis csti04530   Tight junction Brite KEGG Orthology (KO) [BR:csti00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     104551203    04140 Autophagy - animal     104551203   09144 Cellular community - eukaryotes    04530 Tight junction     104551203  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:csti04131]     104551203    03036 Chromosome and associated proteins [BR:csti03036]     104551203   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csti04147]     104551203    04031 GTP-binding proteins [BR:csti04031]     104551203 Membrane trafficking [BR:csti04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     104551203  Autophagy   Other autophagy associated proteins     104551203 Chromosome and associated proteins [BR:csti03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     104551203 Exosome [BR:csti04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104551203   Exosomal proteins of other body fluids (saliva and urine)    104551203   Exosomal proteins of colorectal cancer cells    104551203 GTP-binding proteins [BR:csti04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     104551203 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc DUF3963 Motif Other DBs NCBI-GeneID:  104551203 NCBI-ProteinID:  XP_010198416 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MGIMLVYDITNEKSFENIRNWVRNIEEHASPDVEKMILGNKCDANDKRQVSREQGEKLAA SFGIKFMETSAKANINIENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKKSSF FRCVLL NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgggcattatgttagtctatgacatcaccaatgagaagtcttttgaaaacattcggaac tgggtcaggaacatcgaagagcacgcctctccagatgttgaaaaaatgatccttgggaac aaatgtgatgcaaatgacaaaagacaagtttctagagagcaaggggagaagcttgcagca agttttggaattaaattcatggagaccagtgcaaaagcaaatataaacatagagaatgca tttttcactcttgcaagagatattaaagcaaaaatggacaagaagttggaaggcaatagc ccacaaggcagcaaccagggagtcaaaatcaccccagaccagcaaaagaaaagcagcttt ttccgatgtgttcttctgtga

DBGET integrated database retrieval system