Colius striatus (speckled mousebird): 104551703 Help Entry 104551703         CDS       T08355                                  Name (RefSeq) ADP-ribosylation factor 4   KO K07939   ADP-ribosylation factor 4 Organism csti  Colius striatus (speckled mousebird) Pathway csti04144   Endocytosis Brite KEGG Orthology (KO) [BR:csti00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     104551703  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:csti04131]     104551703   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csti04147]     104551703    04031 GTP-binding proteins [BR:csti04031]     104551703 Membrane trafficking [BR:csti04131]  Endosome - Golgi transport   Arf GTPases and associated proteins    Arf GTPases     104551703 Exosome [BR:csti04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104551703   Exosomal proteins of other body fluids (saliva and urine)    104551703   Exosomal proteins of colorectal cancer cells    104551703 GTP-binding proteins [BR:csti04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     104551703 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Arf Roc SRPRB G-alpha Ras Gtr1_RagA MMR_HSR1 6PF2K AAA_18 Motif Other DBs NCBI-GeneID:  104551703 NCBI-ProteinID:  XP_010194438 LinkDB All DBs Position Unknown AA seq 95 aa AA seqDB search MRFLFILVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDKIR PLWRHYFQNTQGLIFVVDSNDRERIQEAADELQKM NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgcgttttctgtttattctagttggtttggatgctgctggtaagacaactattctttat aagctgaagctaggagaaattgtcaccacaattcccaccattggatttaatgtggaaacg gtagaatataaaaacatttgtttcacagtttgggatgttggtggtcaagataaaattaga cctctttggaggcattatttccaaaacacacagggcctcatttttgtggtagacagcaat gacagagagagaatccaggaagcagcagatgagctgcagaaaatg

DBGET integrated database retrieval system