Colius striatus (speckled mousebird): 104551897 Help Entry 104551897         CDS       T08355                                  Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism csti  Colius striatus (speckled mousebird) Pathway csti04010   MAPK signaling pathway csti04012   ErbB signaling pathway csti04068   FoxO signaling pathway csti04137   Mitophagy - animal csti04140   Autophagy - animal csti04150   mTOR signaling pathway csti04210   Apoptosis csti04218   Cellular senescence csti04370   VEGF signaling pathway csti04371   Apelin signaling pathway csti04540   Gap junction csti04625   C-type lectin receptor signaling pathway csti04810   Regulation of actin cytoskeleton csti04910   Insulin signaling pathway csti04912   GnRH signaling pathway csti04916   Melanogenesis Brite KEGG Orthology (KO) [BR:csti00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104551897    04012 ErbB signaling pathway     104551897    04370 VEGF signaling pathway     104551897    04371 Apelin signaling pathway     104551897    04068 FoxO signaling pathway     104551897    04150 mTOR signaling pathway     104551897  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     104551897    04137 Mitophagy - animal     104551897   09143 Cell growth and death    04210 Apoptosis     104551897    04218 Cellular senescence     104551897   09144 Cellular community - eukaryotes    04540 Gap junction     104551897   09142 Cell motility    04810 Regulation of actin cytoskeleton     104551897  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     104551897   09152 Endocrine system    04910 Insulin signaling pathway     104551897    04912 GnRH signaling pathway     104551897    04916 Melanogenesis     104551897  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:csti04131]     104551897   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csti04147]     104551897    04031 GTP-binding proteins [BR:csti04031]     104551897 Membrane trafficking [BR:csti04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     104551897  Endocytosis   Macropinocytosis    Ras GTPases     104551897 Exosome [BR:csti04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104551897   Exosomal proteins of other body fluids (saliva and urine)    104551897   Exosomal proteins of breast cancer cells    104551897   Exosomal proteins of colorectal cancer cells    104551897 GTP-binding proteins [BR:csti04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     104551897 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf FeoB_N RsgA_GTPase MMR_HSR1 Motif Other DBs NCBI-GeneID:  104551897 NCBI-ProteinID:  XP_010208478 LinkDB All DBs Position Unknown AA seq 166 aa AA seqDB search VESSSATLFSNVLQDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFA INNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAQELAKSYGIPFIE TSAKTRQGVEDAFYTLVREIRQYRMKKLNSSEDGNQGCMGLSCIVM NT seq 501 nt NT seq  +upstreamnt  +downstreamnt gtggaaagcagcagtgccacgcttttctctaatgttttgcaggattcgtatagaaagcag gtggttattgatggagagacgtgtctgttggacatcctggacactgcaggccaggaggag tacagtgccatgcgtgatcagtacatgagaaccggggaaggattcctctgtgtttttgct attaacaacagcaaatcatttgctgatattaacctttacagagaacagatcaagagagtg aaagattcagatgatgtgccaatggtgctagttgggaataagtgtgatttgcccacaaga acagtagacacaaaacaggctcaagaattagcaaaaagttatggaatccccttcatagag acatctgctaaaacaagacagggtgtggaagatgctttttacacactggtgagagagatc cggcagtaccggatgaaaaagctcaacagcagtgaagatgggaaccaaggttgtatggga ttgtcttgcattgtcatgtga

DBGET integrated database retrieval system