Colius striatus (speckled mousebird): 104552084 Help Entry 104552084         CDS       T08355                                  Symbol TXN Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism csti  Colius striatus (speckled mousebird) Pathway csti04621   NOD-like receptor signaling pathway csti05132   Salmonella infection Brite KEGG Orthology (KO) [BR:csti00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     104552084 (TXN)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104552084 (TXN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:csti03110]     104552084 (TXN) Chaperones and folding catalysts [BR:csti03110]  Protein folding catalysts   Protein disulfide isomerase    104552084 (TXN) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 Thioredoxin_2 AhpC-TSA OST3_OST6 Thioredoxin_9 Glutaredoxin DIM1 Thioredoxin_7 Motif Other DBs NCBI-GeneID:  104552084 NCBI-ProteinID:  XP_010205782 LinkDB All DBs Position Unknown AA seq 111 aa AA seqDB search PYHLAGLVKAVSSISEFEEELKSAGDKLVVVDFSATWCGPCKMIKPFFHGLVEKYGDVVF IEVDVDDAQDVATHCDVKCMPTFQFYKSGKKVQEFSGANKEKLEETIKSLV NT seq 338 nt NT seq  +upstreamnt  +downstreamnt gtccataccatctggcaggtttagttaaagctgtttcatctatttctgaatttgaggaag aactgaagtctgctggtgataagcttgtagtagttgatttctctgccacctggtgtggac catgcaaaatgatcaagccctttttccatggtttggttgagaagtatggtgatgtggtgt tcattgaagttgatgtggatgatgcccaggatgtcgctactcactgtgatgtgaagtgta tgccaacgttccagttctacaagagtggaaaaaaggtgcaggagttctctggggccaata aagagaagctggaagagaccattaaaagtctagtctga

DBGET integrated database retrieval system