Colius striatus (speckled mousebird): 104552754 Help Entry 104552754         CDS       T08355                                  Name (RefSeq) profilin-2   KO K05759   profilin Organism csti  Colius striatus (speckled mousebird) Pathway csti04810   Regulation of actin cytoskeleton csti05132   Salmonella infection Brite KEGG Orthology (KO) [BR:csti00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     104552754  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104552754  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:csti04131]     104552754   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:csti04812]     104552754    04147 Exosome [BR:csti04147]     104552754 Membrane trafficking [BR:csti04131]  Others   Actin-binding proteins    Others     104552754 Cytoskeleton proteins [BR:csti04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      104552754 Exosome [BR:csti04147]  Exosomal proteins   Proteins found in most exosomes    104552754 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  104552754 NCBI-ProteinID:  XP_010200225 LinkDB All DBs Position Unknown AA seq 96 aa AA seqDB search PVEIDMIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVG RAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF NT seq 291 nt NT seq  +upstreamnt  +downstreamnt ccagtagaaatagatatgatagtaggaaaagaccgagagggtttcttcaccaatggtctg acccttggtgcaaagaagtgctctgtgatcagagatagcctgtatgttgatggagactgc acaatggacatcaggacaaagagtcaaggtggtgagccaacatacaatgttgctgtaggc agagctggccgagtcttggtctttgtaatgggcaaagaaggggtccatggaggcggattg aataagaaggcatactcaatggcaaaatacttgagagactctgggttctag

DBGET integrated database retrieval system