Colius striatus (speckled mousebird): 104553487 Help Entry 104553487         CDS       T08355                                  Symbol IGF1 Name (RefSeq) insulin-like growth factor I   KO K05459   insulin-like growth factor 1 Organism csti  Colius striatus (speckled mousebird) Pathway csti04010   MAPK signaling pathway csti04068   FoxO signaling pathway csti04081   Hormone signaling csti04114   Oocyte meiosis csti04115   p53 signaling pathway csti04150   mTOR signaling pathway csti04510   Focal adhesion csti04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:csti00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104553487 (IGF1)    04068 FoxO signaling pathway     104553487 (IGF1)    04150 mTOR signaling pathway     104553487 (IGF1)   09133 Signaling molecules and interaction    04081 Hormone signaling     104553487 (IGF1)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     104553487 (IGF1)    04115 p53 signaling pathway     104553487 (IGF1)   09144 Cellular community - eukaryotes    04510 Focal adhesion     104553487 (IGF1)  09150 Organismal Systems   09152 Endocrine system    04914 Progesterone-mediated oocyte maturation     104553487 (IGF1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:csti04052]     104553487 (IGF1) Cytokines and neuropeptides [BR:csti04052]  Cytokines   Growth factors (RTK binding)    104553487 (IGF1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  104553487 NCBI-ProteinID:  XP_010194475 UniProt:  A0A091JXD4 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search MEKINNLSTQLVKCCFCDFLKVKMHTVSYIHFFYLGLCLLTLTNSAAAGPETLCGAELVD ALQFVCGDRGFYFSKPTGYGSSSRRLHHKGIVDECCFQSCDLRRLEMYCAPIKPPKSARS VRAQRHTDMPKAQKEVHLKNTSRGNIGNRNYRM NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggaaaaaatcaacaatctttcaacacaattagttaagtgctgcttttgtgatttcttg aaggtgaagatgcacactgtgtcctatattcatttcttctaccttggcctgtgtttgctt accctaaccaattctgctgctgctggcccagaaacactctgtggtgctgagctggttgat gctcttcagttcgtctgtggagacagaggcttttacttcagtaagcctacagggtatgga tccagcagtagacgcttacatcacaagggaatagtggatgaatgctgcttccagagttgt gacctgaggaggctggagatgtattgtgctccaataaagccacctaaatctgcacgctct gtacgtgcccagcgccacactgatatgccaaaagcacaaaaggaagtgcatttgaagaat acaagcagagggaatataggaaacagaaactacagaatgtaa

DBGET integrated database retrieval system