Colius striatus (speckled mousebird): 104554735 Help Entry 104554735         CDS       T08355                                  Symbol NME6 Name (RefSeq) nucleoside diphosphate kinase 6   KO K00940   nucleoside-diphosphate kinase [EC:2.7.4.6] Organism csti  Colius striatus (speckled mousebird) Pathway csti00230   Purine metabolism csti00240   Pyrimidine metabolism csti00983   Drug metabolism - other enzymes csti01100   Metabolic pathways csti01232   Nucleotide metabolism csti01240   Biosynthesis of cofactors Module csti_M00049   Adenine ribonucleotide biosynthesis, IMP => ADP,ATP csti_M00052   Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP Brite KEGG Orthology (KO) [BR:csti00001]  09100 Metabolism   09104 Nucleotide metabolism    00230 Purine metabolism     104554735 (NME6)    00240 Pyrimidine metabolism     104554735 (NME6)   09111 Xenobiotics biodegradation and metabolism    00983 Drug metabolism - other enzymes     104554735 (NME6)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:csti04131]     104554735 (NME6) Enzymes [BR:csti01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.4  Phosphotransferases with a phosphate group as acceptor     2.7.4.6  nucleoside-diphosphate kinase      104554735 (NME6) Membrane trafficking [BR:csti04131]  Exocytosis   Calcium ion-dependent exocytosis    Kinases and associated proteins     104554735 (NME6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  NDK Motif Other DBs NCBI-GeneID:  104554735 NCBI-ProteinID:  XP_010196184 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search GPMWAYILAHENAVSLWRSLMGPTKVFRARNSVPDSIRGAYGLTDTRNTTHGSASASREI AFFFPEFSEQRWYEQEEPRLRGGRVFYSAEERVHRPCIPAGAELT NT seq 319 nt NT seq  +upstreamnt  +downstreamnt tggccccatgtgggcttacatcttggcacatgagaacgccgtgtccctctggagatccct gatgggacccactaaagtattccgagcccggaacagtgtcccagactccatccgaggagc ctacggcctcaccgacaccaggaacaccactcacggctcagcgtcagccagcagagaaat cgcgtttttcttccccgagttcagcgagcagcgctggtacgagcaggaggagccgcggct gcgcggcgggcgggtgttctacagcgcggaggagcgcgtgcaccgcccgtgcatccctgc aggcgcagagctgacctga

DBGET integrated database retrieval system