Colius striatus (speckled mousebird): 104555353 Help Entry 104555353         CDS       T08355                                  Name (RefSeq) calmodulin, striated muscle-like   KO K02183   calmodulin Organism csti  Colius striatus (speckled mousebird) Pathway csti04020   Calcium signaling pathway csti04070   Phosphatidylinositol signaling system csti04114   Oocyte meiosis csti04218   Cellular senescence csti04261   Adrenergic signaling in cardiomyocytes csti04270   Vascular smooth muscle contraction csti04371   Apelin signaling pathway csti04625   C-type lectin receptor signaling pathway csti04744   Phototransduction csti04910   Insulin signaling pathway csti04912   GnRH signaling pathway csti04916   Melanogenesis Brite KEGG Orthology (KO) [BR:csti00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     104555353    04020 Calcium signaling pathway     104555353    04070 Phosphatidylinositol signaling system     104555353  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     104555353    04218 Cellular senescence     104555353  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     104555353   09152 Endocrine system    04910 Insulin signaling pathway     104555353    04912 GnRH signaling pathway     104555353    04916 Melanogenesis     104555353   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     104555353    04270 Vascular smooth muscle contraction     104555353   09157 Sensory system    04744 Phototransduction     104555353  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:csti01009]     104555353   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:csti04131]     104555353    03036 Chromosome and associated proteins [BR:csti03036]     104555353   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csti04147]     104555353 Protein phosphatases and associated proteins [BR:csti01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      104555353 Membrane trafficking [BR:csti04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     104555353 Chromosome and associated proteins [BR:csti03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      104555353 Exosome [BR:csti04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    104555353 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EF_EFCAB10_C EFhand_Ca_insen Dockerin_1 EF-hand_11 SPARC_Ca_bdg EH Caleosin FCaBP_EF-hand DUF5580_M SurA_N_2 TerB SurA_N_3 Motif Other DBs NCBI-GeneID:  104555353 NCBI-ProteinID:  XP_010197031 UniProt:  A0A091KRQ9 LinkDB All DBs Position Unknown AA seq 147 aa AA seqDB search MAEQLTERQIAEFKEAFSLFDRDGDGRISSAELGTAMRSLGRNPTEAELRDMVREADGSG SVDFGEFLALMARKMRASDSEEGIREAFRVFDKDGNGYISAAELRHVMTKLGEKLTDEEV DEMIKEADSNNDGQVNYEEFVRMMMEK NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atggccgagcagctgacggagcggcagatcgcggagttcaaagaagctttttccctcttc gaccgggacggcgacggccgcatcagcagcgcggagctgggcacggccatgcgctcgctg ggtcggaaccccacggaggctgagctgcgggacatggtgcgagaagccgacggcagcggc tccgtggatttcggcgagttcttggcgttgatggcgaggaagatgagagcctcggatagc gaggaagggatccgggaagccttcagggtgttcgataaagacggcaacggttacatcagc gcggccgagctgcggcacgtcatgaccaagctgggagagaagctgacggacgaggaggtg gatgagatgatcaaagaggccgacagcaacaacgacgggcaggtcaactacgaggagttc gtgaggatgatgatggagaagtga

DBGET integrated database retrieval system