Colius striatus (speckled mousebird): 104556073 Help Entry 104556073         CDS       T08355                                  Symbol INS Name (RefSeq) insulin   KO K04526   insulin Organism csti  Colius striatus (speckled mousebird) Pathway csti04010   MAPK signaling pathway csti04068   FoxO signaling pathway csti04081   Hormone signaling csti04114   Oocyte meiosis csti04140   Autophagy - animal csti04150   mTOR signaling pathway csti04810   Regulation of actin cytoskeleton csti04910   Insulin signaling pathway csti04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:csti00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104556073 (INS)    04068 FoxO signaling pathway     104556073 (INS)    04150 mTOR signaling pathway     104556073 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     104556073 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     104556073 (INS)   09143 Cell growth and death    04114 Oocyte meiosis     104556073 (INS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     104556073 (INS)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     104556073 (INS)    04914 Progesterone-mediated oocyte maturation     104556073 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:csti04052]     104556073 (INS) Cytokines and neuropeptides [BR:csti04052]  Neuropeptides   Unclassified    104556073 (INS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  104556073 NCBI-ProteinID:  XP_010198080 UniProt:  A0A091K077 LinkDB All DBs Position Unknown AA seq 107 aa AA seqDB search MALWIQSLPLLALLALSGPGTSHAAAAQHLCGSHLVEALYLVCGERGFFYSPKARRDIEQ PLVSGPLHGEVGELPFHQEEFEKVKRGIVEQCCHNTCSLYQLENYCN NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggctctctggatccagtcgctgcctctcctggcccttctcgccctttctggccctggg accagccacgctgctgctgcccagcacctctgtggctcccacttggtggaggctctctac ctggtgtgtggagagagaggtttcttctactcccccaaagcccgccgggacatcgagcag cctctggtgagcggtcccttgcacggtgaggtaggagagctgcccttccatcaggaggag tttgagaaagtgaagcgggggatcgttgagcaatgctgccacaacacctgctccctgtac caactggaaaactactgcaactag

DBGET integrated database retrieval system