Colius striatus (speckled mousebird): 104556077 Help Entry 104556077         CDS       T08355                                  Name (RefSeq) UPF0691 protein C9orf116 homolog   KO K28113   piercer of microtubule wall 1 protein Organism csti  Colius striatus (speckled mousebird) Brite KEGG Orthology (KO) [BR:csti00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:csti03037]     104556077 Cilium and associated proteins [BR:csti03037]  Motile cilia and associated proteins   Other motile cilia associated proteins    104556077 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PIRC1_2 Motif Other DBs NCBI-GeneID:  104556077 NCBI-ProteinID:  XP_010198084 LinkDB All DBs Position Unknown AA seq 59 aa AA seqDB search FHVTSHAFSNALAPCGMYRNNGLNTSLEKSHVTGTANFITASDHLNFQPSYNPSSPSHC NT seq 180 nt NT seq  +upstreamnt  +downstreamnt ttccacgtcacctcgcacgcgttttccaacgctctggcaccgtgtggcatgtacagaaat aacgggctcaacacctccctggagaagagccatgtcaccggcactgccaacttcatcact gccagtgaccacctcaacttccagcccagctacaaccccagctccccgtcacactgttag

DBGET integrated database retrieval system