Colius striatus (speckled mousebird): 104556106 Help Entry 104556106         CDS       T08355                                  Symbol RAB33B Name (RefSeq) ras-related protein Rab-33B   KO K07920   Ras-related protein Rab-33B Organism csti  Colius striatus (speckled mousebird) Pathway csti04140   Autophagy - animal Brite KEGG Orthology (KO) [BR:csti00001]  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     104556106 (RAB33B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:csti04131]     104556106 (RAB33B)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csti04147]     104556106 (RAB33B)    04031 GTP-binding proteins [BR:csti04031]     104556106 (RAB33B) Membrane trafficking [BR:csti04131]  Endoplasmic reticulum (ER) - Golgi transport   Retrieval pathways    Rab GTPases     104556106 (RAB33B)  Others   Specific organelles associated proteins    Auto phagosome     104556106 (RAB33B) Exosome [BR:csti04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    104556106 (RAB33B) GTP-binding proteins [BR:csti04031]  Small (monomeric) G-proteins   Rab Family    Rab33     104556106 (RAB33B) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU G-alpha Gtr1_RagA ATP_bind_1 MMR_HSR1 Motif Other DBs NCBI-GeneID:  104556106 NCBI-ProteinID:  XP_010198128 LinkDB All DBs Position Unknown AA seq 147 aa AA seqDB search IQLWDTAGQERFRKSMVQHYYRNVHAVVFVYDMTNIASFHSLPSWIEECKQHLLANDIPR ILVGNKCDLRSAIQVPTDLAQKFADTHSMPLFETSAKNPNDNDHVEAIFMTLAHKLKSHK PLMLSQPPDHSEIHIKPEPKPAMTCWC NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atccagctgtgggatacggcgggccaggagcgcttccggaagagcatggtgcagcactac tacaggaacgtacacgcggtcgtgttcgtgtatgatatgacaaacattgccagttttcac agtctgccctcatggatagaggagtgcaaacagcaccttcttgccaacgatataccgcgg attcttgttggaaataaatgtgacctgaggagcgctattcaggtgcctacggacttggcc cagaagtttgctgatactcacagtatgccgttatttgaaacctctgccaaaaaccccaat gacaatgaccatgtggaggccatatttatgacgctggctcacaagcttaaaagtcacaag cctttaatgcttagtcaacccccagatcacagtgaaatacatataaagcctgaaccgaaa cctgccatgacctgctggtgttaa

DBGET integrated database retrieval system