Colius striatus (speckled mousebird): 104556319 Help Entry 104556319         CDS       T08355                                  Symbol NFKBIA Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism csti  Colius striatus (speckled mousebird) Pathway csti04210   Apoptosis csti04620   Toll-like receptor signaling pathway csti04621   NOD-like receptor signaling pathway csti04622   RIG-I-like receptor signaling pathway csti04623   Cytosolic DNA-sensing pathway csti04625   C-type lectin receptor signaling pathway csti04920   Adipocytokine signaling pathway csti05132   Salmonella infection csti05164   Influenza A csti05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:csti00001]  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     104556319 (NFKBIA)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     104556319 (NFKBIA)    04621 NOD-like receptor signaling pathway     104556319 (NFKBIA)    04622 RIG-I-like receptor signaling pathway     104556319 (NFKBIA)    04623 Cytosolic DNA-sensing pathway     104556319 (NFKBIA)    04625 C-type lectin receptor signaling pathway     104556319 (NFKBIA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     104556319 (NFKBIA)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     104556319 (NFKBIA)    05168 Herpes simplex virus 1 infection     104556319 (NFKBIA)   09171 Infectious disease: bacterial    05132 Salmonella infection     104556319 (NFKBIA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:csti03000]     104556319 (NFKBIA)    04131 Membrane trafficking [BR:csti04131]     104556319 (NFKBIA) Transcription factors [BR:csti03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     104556319 (NFKBIA) Membrane trafficking [BR:csti04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     104556319 (NFKBIA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_4 Ank_5 ANK_LRRK2 Ank_KRIT1 Motif Other DBs NCBI-GeneID:  104556319 NCBI-ProteinID:  XP_010198424 LinkDB All DBs Position Unknown AA seq 176 aa AA seqDB search MRDFRGNTPLHIACQQGSLRNVGVLTQHCQPHHLLTVLQATNYNGHTCLHLASIQGYLAI VEYLLSLGADINAQEPCNGRTALHLAVDLQNSDLVSLLVKHGADVNKVTYQGYSPCQLTW GRDNSSIQEQLKQLTTADLQMLPESEDEESSESEPEFTEDELMYDDCLIGGRQLAF NT seq 531 nt NT seq  +upstreamnt  +downstreamnt atgagggacttccgaggaaacactcccctccacattgcctgccagcagggctccctgcgg aacgtcggtgtcctcacacagcactgccagcctcaccacctcctcactgtcctacaggcc actaactacaacggacatacctgtctccatttggcatctattcagggatacctggctatt gttgaatacttgctgtccttgggagcagatataaatgctcaggagccatgcaacggcaga accgcactacatttggctgttgacctgcagaattcagacctggtgtcacttctggtgaaa catggggcagatgtgaacaaagtgacctaccagggctattccccctgtcagctcacatgg ggaagagacaactccagcatacaggaacagctgaagcagctgaccacagccgacctgcag atgttaccagaaagtgaggatgaggagagcagtgaatcagagcccgaattcactgaggat gaacttatgtatgatgactgccttattggaggacgacagctggcattttaa

DBGET integrated database retrieval system