Colius striatus (speckled mousebird): 104556868 Help Entry 104556868         CDS       T08355                                  Name (RefSeq) interleukin-8   KO K10030   interleukin 8 Organism csti  Colius striatus (speckled mousebird) Pathway csti04060   Cytokine-cytokine receptor interaction csti04218   Cellular senescence csti04620   Toll-like receptor signaling pathway csti04621   NOD-like receptor signaling pathway csti04622   RIG-I-like receptor signaling pathway csti05132   Salmonella infection csti05164   Influenza A Brite KEGG Orthology (KO) [BR:csti00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     104556868  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     104556868  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     104556868    04621 NOD-like receptor signaling pathway     104556868    04622 RIG-I-like receptor signaling pathway     104556868  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     104556868   09171 Infectious disease: bacterial    05132 Salmonella infection     104556868  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:csti04052]     104556868    00536 Glycosaminoglycan binding proteins [BR:csti00536]     104556868 Cytokines and neuropeptides [BR:csti04052]  Cytokines   Chemokines    104556868 Glycosaminoglycan binding proteins [BR:csti00536]  Heparan sulfate / Heparin   Chemokines    104556868 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Ig_J_chain Motif Other DBs NCBI-GeneID:  104556868 NCBI-ProteinID:  XP_010199189 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MNGKLVAVLALFLISAAMSQGMTLARMATELRCQCVATHSKFIPPKSIQDVKLTQSGPHC KNVEVIATLKDGREVCLEPTAPWVQLIIKAILAKAQLNSDSPL NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgaacggcaaattggtggctgtcctggctctcttcctgatttcagcagctatgtctcaa ggtatgaccctggcaaggatggcaactgagctccggtgccagtgtgtagccactcattca aagttcatccctcctaaatccattcaagatgtcaagctgacacagagtggcccccactgc aagaatgttgaagtcatagctactctgaaggacggcagagaggtgtgcttggagcccact gctccctgggtgcagttgatcataaaggcaattttggccaaagcccaactcaattctgac tcgccactctaa

DBGET integrated database retrieval system