Colius striatus (speckled mousebird): 104562345 Help Entry 104562345         CDS       T08355                                  Name (RefSeq) fibroblast growth factor 9   KO K04358   fibroblast growth factor Organism csti  Colius striatus (speckled mousebird) Pathway csti04010   MAPK signaling pathway csti04020   Calcium signaling pathway csti04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:csti00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104562345    04020 Calcium signaling pathway     104562345  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     104562345  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:csti04052]     104562345    00536 Glycosaminoglycan binding proteins [BR:csti00536]     104562345 Cytokines and neuropeptides [BR:csti04052]  Cytokines   Growth factors (RTK binding)    104562345 Glycosaminoglycan binding proteins [BR:csti00536]  Heparan sulfate / Heparin   Growth factors/receptors    104562345 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  104562345 NCBI-ProteinID:  XP_010206692 LinkDB All DBs Position Unknown AA seq 115 aa AA seqDB search ILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLY KHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPEKVPELYKDILSQS NT seq 350 nt NT seq  +upstreamnt  +downstreamnt gtatactggaatttatcagtatagcagtgggcttggtcagcatccgaggagttgacagtg gactctaccttggaatgaatgagaaaggggaactgtatggctcggaaaaattaacccagg agtgtgtattcagagagcagtttgaagaaaactggtataacacatattcatcaaatctat ataaacacgtggacactggaagacgatactacgttgcgttaaataaagatgggactccaa gagaagggactaggactaagcggcatcaaaaatttacacattttttacctagaccagtgg accctgagaaagtaccggaactatataaggatattttaagccaaagttga

DBGET integrated database retrieval system