Colius striatus (speckled mousebird): 104564096 Help Entry 104564096         CDS       T08355                                  Symbol BTG1 Name (RefSeq) protein BTG1   KO K14443   protein Tob/BTG Organism csti  Colius striatus (speckled mousebird) Pathway csti03018   RNA degradation Brite KEGG Orthology (KO) [BR:csti00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     104564096 (BTG1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:csti03019]     104564096 (BTG1) Messenger RNA biogenesis [BR:csti03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      104564096 (BTG1)   mRNA degradation factors    3'-5' decay     Other 3'-5' decay factors      104564096 (BTG1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  BTG Motif Other DBs NCBI-GeneID:  104564096 NCBI-ProteinID:  XP_010209085 LinkDB All DBs Position Unknown AA seq 120 aa AA seqDB search HYKHHWFPEKPCKGSGYRCIRINHKMDPLIGQAAQRIGLSSQELFQLLPSELTLWVDPYE VSYRIGEDGSICVLYEAAPAGGSQNNTNMQMVDSRISCKEELLLGRTSPSKSYNMMTVSG NT seq 365 nt NT seq  +upstreamnt  +downstreamnt aacattataaacaccactggttcccagaaaagccatgcaagggatcaggttaccgatgta tccggatcaaccataaaatggatcctctgattggacaggcagcacagcggattggattga gcagtcaggaactgttccagcttcttcccagcgaactcactctatgggttgacccgtatg aagtgtcctatcgcattggagaggatggctcaatctgtgtgctgtatgaagctgcaccag caggaggtagccaaaataacaccaacatgcagatggtagacagcagaataagctgtaagg aggaacttctcttgggcagaactagcccttccaaaagctacaatatgatgactgtatcgg gttaa

DBGET integrated database retrieval system