Corynebacterium striatum: CBE89_10770 Help Entry CBE89_10770       CDS       T05059                                  Name (GenBank) hypothetical protein   KO K27095   acyl-CoA carboxylase epsilon subunit Organism cstr  Corynebacterium striatum Pathway cstr00074   Mycolic acid biosynthesis cstr00280   Valine, leucine and isoleucine degradation cstr00630   Glyoxylate and dicarboxylate metabolism cstr00640   Propanoate metabolism cstr01100   Metabolic pathways cstr01110   Biosynthesis of secondary metabolites cstr01120   Microbial metabolism in diverse environments cstr01200   Carbon metabolism Module cstr_M00887   Mycolic acid biosynthesis, meromycolic acid + alpha-carboxyacyl-CoA + trehalose => TMM => TDM/mAGP/GMM Brite KEGG Orthology (KO) [BR:cstr00001]  09100 Metabolism   09101 Carbohydrate metabolism    00630 Glyoxylate and dicarboxylate metabolism     CBE89_10770    00640 Propanoate metabolism     CBE89_10770   09103 Lipid metabolism    00074 Mycolic acid biosynthesis     CBE89_10770   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     CBE89_10770 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACC_epsilon Motif Other DBs NCBI-ProteinID:  ART21917 UniProt:  A0A2H1ABQ7 LinkDB All DBs Position 2273916..2274140 Genome browser AA seq 74 aa AA seqDB search MTAPAFRVLKGNPSDDEVAALTAVLAQLSADARAKQAGSDAGERNLWGRLDERFDAYGAQ DVFNPSAFRNVRYY NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgaccgcaccagcatttcgtgtactcaagggcaacccctccgacgatgaggttgccgca cttaccgcagtcctagcgcagctcagtgctgatgcccgcgcaaagcaggccggttctgac gccggcgagcgcaacctgtggggccgcctcgacgagcgtttcgacgcatacggtgcacag gacgtcttcaacccgtccgccttccgcaacgtgcgttactactaa

DBGET integrated database retrieval system