KEGG   Cytobacillus suaedae: IM538_02145
Entry
IM538_02145       CDS       T08143                                 
Name
(GenBank) cytochrome P450
  KO
K16593  pimeloyl-[acyl-carrier protein] synthase [EC:1.14.14.46]
Organism
csua  Cytobacillus suaedae
Pathway
csua00780  Biotin metabolism
csua01100  Metabolic pathways
csua01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:csua00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    IM538_02145
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:csua00199]
    IM538_02145
Enzymes [BR:csua01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.46  pimeloyl-[acyl-carrier protein] synthase
     IM538_02145
Cytochrome P450 [BR:csua00199]
 Cytochrome P450, bacteria type
  CYP107 family
   IM538_02145
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: QOR66998
LinkDB
Position
complement(411111..412319)
AA seq 402 aa
MLNSITPDLFINDPYSIFNAARENNPVLFGNFLNSTGWLITGYKEAEFALKDPRFIKEGR
KLFPPENLATFSERVMPAIELTRNMMLFRDAPDHTRLRNLVNKAFTPKMVDRLRPAIEDI
ASYLLTARQGQSQHELIRDFSYLLPVFVITELLGVPKEDRELFRKWSDAFIKFIDFNTTM
DDLESVSDDLKEASHYFRELISIKRNSPQEDLLSGLIQAEANGDNLNEDEMIATCLLLLV
AGHETTVNLITNAYYLLLTHPEQLKLVQEDRTLISNVVEETLRFEPPVLMTSRWIAEDME
LAGQQLKKGQIAFISLAGANRDPLINEDPNSFNIQRDTLKHLSFASGPHFCLGAPLARLE
GIIALEKLVECFANPRLLEKPIWRKNIAFRGFEALHFEAETR
NT seq 1209 nt   +upstreamnt  +downstreamnt
atgttaaatagtattactcccgacttatttattaacgacccttattcaatctttaatgca
gctcgagaaaataatcctgttctgtttggaaacttccttaattcaacaggttggctcatt
actggctataaggaggccgaatttgcattaaaagaccctaggtttattaaagagggccga
aaactatttcctcctgagaatctagcaaccttttctgagagggttatgccagcaattgag
cttaccagaaatatgatgctgtttcgagatgcgccagaccatacacgccttcgtaatctc
gtgaataaagcttttacacctaaaatggtagaccgcttacgtccagctatagaagatatc
gcttcttatctcttaactgctcgtcagggacagtctcaacatgagctaatccgagatttt
tcatatctattacctgtgtttgtaatcactgagctgttaggtgtgcctaaagaagatcgc
gagcttttccgcaaatggtctgatgcatttataaagttcattgattttaatacaacaatg
gatgatttagaatctgtttcagacgaccttaaagaagcaagccactattttcgtgaactc
atttctataaaaagaaactctccacaagaagatttactaagcggtttaatacaagctgaa
gcaaatggagataaccttaacgaagatgaaatgatcgctacttgtttacttttgctagtt
gctggtcatgaaacaacggtgaacctcattaccaatgcctattatttgttacttacacat
ccagaacaattgaagctcgttcaagaggatcgtactctaatttcaaatgtcgttgaggaa
acattacggtttgagccaccagttttaatgacgtcaagatggattgcagaagatatggag
ttggcaggacaacaattgaaaaaaggccagattgcctttatttcgttagcaggagcaaat
cgagaccctttaattaacgaggatccaaattcatttaacattcaacgagacacccttaag
catttatcattcgcttctggtcctcacttctgtcttggtgcaccacttgctagacttgaa
ggaatcattgcattagaaaaactagtagagtgctttgcaaacccgcgcttacttgagaag
cctatatggagaaaaaatatcgcattccgtggatttgaagccttacattttgaagcagaa
acgaggtag

DBGET integrated database retrieval system