KEGG   Capricornis sumatraensis (Sumatran serow): 138070578
Entry
138070578         CDS       T10522                                 
Symbol
NRAS
Name
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
csum  Capricornis sumatraensis (Sumatran serow)
Pathway
csum01521  EGFR tyrosine kinase inhibitor resistance
csum01522  Endocrine resistance
csum04010  MAPK signaling pathway
csum04012  ErbB signaling pathway
csum04014  Ras signaling pathway
csum04015  Rap1 signaling pathway
csum04062  Chemokine signaling pathway
csum04068  FoxO signaling pathway
csum04071  Sphingolipid signaling pathway
csum04072  Phospholipase D signaling pathway
csum04137  Mitophagy - animal
csum04140  Autophagy - animal
csum04150  mTOR signaling pathway
csum04151  PI3K-Akt signaling pathway
csum04210  Apoptosis
csum04211  Longevity regulating pathway
csum04213  Longevity regulating pathway - multiple species
csum04218  Cellular senescence
csum04360  Axon guidance
csum04370  VEGF signaling pathway
csum04371  Apelin signaling pathway
csum04519  Cadherin signaling
csum04540  Gap junction
csum04550  Signaling pathways regulating pluripotency of stem cells
csum04625  C-type lectin receptor signaling pathway
csum04650  Natural killer cell mediated cytotoxicity
csum04660  T cell receptor signaling pathway
csum04662  B cell receptor signaling pathway
csum04664  Fc epsilon RI signaling pathway
csum04714  Thermogenesis
csum04720  Long-term potentiation
csum04722  Neurotrophin signaling pathway
csum04725  Cholinergic synapse
csum04726  Serotonergic synapse
csum04730  Long-term depression
csum04810  Regulation of actin cytoskeleton
csum04910  Insulin signaling pathway
csum04912  GnRH signaling pathway
csum04915  Estrogen signaling pathway
csum04916  Melanogenesis
csum04917  Prolactin signaling pathway
csum04919  Thyroid hormone signaling pathway
csum04921  Oxytocin signaling pathway
csum04926  Relaxin signaling pathway
csum04929  GnRH secretion
csum04933  AGE-RAGE signaling pathway in diabetic complications
csum04935  Growth hormone synthesis, secretion and action
csum05010  Alzheimer disease
csum05022  Pathways of neurodegeneration - multiple diseases
csum05034  Alcoholism
csum05160  Hepatitis C
csum05161  Hepatitis B
csum05163  Human cytomegalovirus infection
csum05165  Human papillomavirus infection
csum05166  Human T-cell leukemia virus 1 infection
csum05167  Kaposi sarcoma-associated herpesvirus infection
csum05170  Human immunodeficiency virus 1 infection
csum05200  Pathways in cancer
csum05203  Viral carcinogenesis
csum05205  Proteoglycans in cancer
csum05206  MicroRNAs in cancer
csum05207  Chemical carcinogenesis - receptor activation
csum05208  Chemical carcinogenesis - reactive oxygen species
csum05210  Colorectal cancer
csum05211  Renal cell carcinoma
csum05213  Endometrial cancer
csum05214  Glioma
csum05215  Prostate cancer
csum05216  Thyroid cancer
csum05218  Melanoma
csum05219  Bladder cancer
csum05220  Chronic myeloid leukemia
csum05221  Acute myeloid leukemia
csum05223  Non-small cell lung cancer
csum05224  Breast cancer
csum05225  Hepatocellular carcinoma
csum05226  Gastric cancer
csum05230  Central carbon metabolism in cancer
csum05231  Choline metabolism in cancer
csum05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
csum05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:csum00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    138070578 (NRAS)
   04012 ErbB signaling pathway
    138070578 (NRAS)
   04014 Ras signaling pathway
    138070578 (NRAS)
   04015 Rap1 signaling pathway
    138070578 (NRAS)
   04370 VEGF signaling pathway
    138070578 (NRAS)
   04371 Apelin signaling pathway
    138070578 (NRAS)
   04068 FoxO signaling pathway
    138070578 (NRAS)
   04072 Phospholipase D signaling pathway
    138070578 (NRAS)
   04071 Sphingolipid signaling pathway
    138070578 (NRAS)
   04151 PI3K-Akt signaling pathway
    138070578 (NRAS)
   04150 mTOR signaling pathway
    138070578 (NRAS)
  09133 Signaling molecules and interaction
   04519 Cadherin signaling
    138070578 (NRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    138070578 (NRAS)
   04137 Mitophagy - animal
    138070578 (NRAS)
  09143 Cell growth and death
   04210 Apoptosis
    138070578 (NRAS)
   04218 Cellular senescence
    138070578 (NRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    138070578 (NRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    138070578 (NRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    138070578 (NRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    138070578 (NRAS)
   04650 Natural killer cell mediated cytotoxicity
    138070578 (NRAS)
   04660 T cell receptor signaling pathway
    138070578 (NRAS)
   04662 B cell receptor signaling pathway
    138070578 (NRAS)
   04664 Fc epsilon RI signaling pathway
    138070578 (NRAS)
   04062 Chemokine signaling pathway
    138070578 (NRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    138070578 (NRAS)
   04929 GnRH secretion
    138070578 (NRAS)
   04912 GnRH signaling pathway
    138070578 (NRAS)
   04915 Estrogen signaling pathway
    138070578 (NRAS)
   04917 Prolactin signaling pathway
    138070578 (NRAS)
   04921 Oxytocin signaling pathway
    138070578 (NRAS)
   04926 Relaxin signaling pathway
    138070578 (NRAS)
   04935 Growth hormone synthesis, secretion and action
    138070578 (NRAS)
   04919 Thyroid hormone signaling pathway
    138070578 (NRAS)
   04916 Melanogenesis
    138070578 (NRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    138070578 (NRAS)
   04726 Serotonergic synapse
    138070578 (NRAS)
   04720 Long-term potentiation
    138070578 (NRAS)
   04730 Long-term depression
    138070578 (NRAS)
   04722 Neurotrophin signaling pathway
    138070578 (NRAS)
  09158 Development and regeneration
   04360 Axon guidance
    138070578 (NRAS)
  09149 Aging
   04211 Longevity regulating pathway
    138070578 (NRAS)
   04213 Longevity regulating pathway - multiple species
    138070578 (NRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    138070578 (NRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    138070578 (NRAS)
   05206 MicroRNAs in cancer
    138070578 (NRAS)
   05205 Proteoglycans in cancer
    138070578 (NRAS)
   05207 Chemical carcinogenesis - receptor activation
    138070578 (NRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    138070578 (NRAS)
   05203 Viral carcinogenesis
    138070578 (NRAS)
   05230 Central carbon metabolism in cancer
    138070578 (NRAS)
   05231 Choline metabolism in cancer
    138070578 (NRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    138070578 (NRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    138070578 (NRAS)
   05225 Hepatocellular carcinoma
    138070578 (NRAS)
   05226 Gastric cancer
    138070578 (NRAS)
   05214 Glioma
    138070578 (NRAS)
   05216 Thyroid cancer
    138070578 (NRAS)
   05221 Acute myeloid leukemia
    138070578 (NRAS)
   05220 Chronic myeloid leukemia
    138070578 (NRAS)
   05218 Melanoma
    138070578 (NRAS)
   05211 Renal cell carcinoma
    138070578 (NRAS)
   05219 Bladder cancer
    138070578 (NRAS)
   05215 Prostate cancer
    138070578 (NRAS)
   05213 Endometrial cancer
    138070578 (NRAS)
   05224 Breast cancer
    138070578 (NRAS)
   05223 Non-small cell lung cancer
    138070578 (NRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    138070578 (NRAS)
   05170 Human immunodeficiency virus 1 infection
    138070578 (NRAS)
   05161 Hepatitis B
    138070578 (NRAS)
   05160 Hepatitis C
    138070578 (NRAS)
   05163 Human cytomegalovirus infection
    138070578 (NRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    138070578 (NRAS)
   05165 Human papillomavirus infection
    138070578 (NRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    138070578 (NRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    138070578 (NRAS)
  09165 Substance dependence
   05034 Alcoholism
    138070578 (NRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    138070578 (NRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    138070578 (NRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    138070578 (NRAS)
   01522 Endocrine resistance
    138070578 (NRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:csum04131]
    138070578 (NRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:csum04147]
    138070578 (NRAS)
   04031 GTP-binding proteins [BR:csum04031]
    138070578 (NRAS)
Membrane trafficking [BR:csum04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    138070578 (NRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    138070578 (NRAS)
Exosome [BR:csum04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   138070578 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   138070578 (NRAS)
  Exosomal proteins of breast cancer cells
   138070578 (NRAS)
  Exosomal proteins of colorectal cancer cells
   138070578 (NRAS)
GTP-binding proteins [BR:csum04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    138070578 (NRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N
Other DBs
NCBI-GeneID: 138070578
NCBI-ProteinID: XP_068817974
LinkDB
Position
2
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CMGLPCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagtgcactgaca
atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcctac
cgaaaacaggtggttatagatggtgaaacctgtctgttggacatactggatacagctgga
caagaggagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctttgt
gtatttgccatcaataatagcaaatcatttgcagatattaacctctacagggaacagatt
aagcgtgtaaaggactcggatgatgtacctatggtgctagtaggaaacaagtgtgacttg
ccaacaaggacagttgacacaaaacaagcccatgaactggccaaaagctatgggattcca
ttcattgaaacctcagccaagaccagacagggtgttgaagatgccttttacacactggta
agagaaatacgtcagtaccgaatgaaaaaactcaacagcagtgatgatggcactcaaggt
tgtatggggttgccatgtgtggtaatgtaa

DBGET integrated database retrieval system