KEGG   Capricornis sumatraensis (Sumatran serow): 138075362
Entry
138075362         CDS       T10522                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
csum  Capricornis sumatraensis (Sumatran serow)
Pathway
csum01521  EGFR tyrosine kinase inhibitor resistance
csum01522  Endocrine resistance
csum01524  Platinum drug resistance
csum04010  MAPK signaling pathway
csum04012  ErbB signaling pathway
csum04014  Ras signaling pathway
csum04015  Rap1 signaling pathway
csum04022  cGMP-PKG signaling pathway
csum04024  cAMP signaling pathway
csum04062  Chemokine signaling pathway
csum04066  HIF-1 signaling pathway
csum04068  FoxO signaling pathway
csum04071  Sphingolipid signaling pathway
csum04072  Phospholipase D signaling pathway
csum04114  Oocyte meiosis
csum04140  Autophagy - animal
csum04148  Efferocytosis
csum04150  mTOR signaling pathway
csum04151  PI3K-Akt signaling pathway
csum04210  Apoptosis
csum04218  Cellular senescence
csum04261  Adrenergic signaling in cardiomyocytes
csum04270  Vascular smooth muscle contraction
csum04350  TGF-beta signaling pathway
csum04360  Axon guidance
csum04370  VEGF signaling pathway
csum04371  Apelin signaling pathway
csum04380  Osteoclast differentiation
csum04510  Focal adhesion
csum04520  Adherens junction
csum04540  Gap junction
csum04550  Signaling pathways regulating pluripotency of stem cells
csum04611  Platelet activation
csum04613  Neutrophil extracellular trap formation
csum04620  Toll-like receptor signaling pathway
csum04621  NOD-like receptor signaling pathway
csum04625  C-type lectin receptor signaling pathway
csum04650  Natural killer cell mediated cytotoxicity
csum04657  IL-17 signaling pathway
csum04658  Th1 and Th2 cell differentiation
csum04659  Th17 cell differentiation
csum04660  T cell receptor signaling pathway
csum04662  B cell receptor signaling pathway
csum04664  Fc epsilon RI signaling pathway
csum04666  Fc gamma R-mediated phagocytosis
csum04668  TNF signaling pathway
csum04713  Circadian entrainment
csum04720  Long-term potentiation
csum04722  Neurotrophin signaling pathway
csum04723  Retrograde endocannabinoid signaling
csum04724  Glutamatergic synapse
csum04725  Cholinergic synapse
csum04726  Serotonergic synapse
csum04730  Long-term depression
csum04810  Regulation of actin cytoskeleton
csum04910  Insulin signaling pathway
csum04912  GnRH signaling pathway
csum04914  Progesterone-mediated oocyte maturation
csum04915  Estrogen signaling pathway
csum04916  Melanogenesis
csum04917  Prolactin signaling pathway
csum04919  Thyroid hormone signaling pathway
csum04921  Oxytocin signaling pathway
csum04926  Relaxin signaling pathway
csum04928  Parathyroid hormone synthesis, secretion and action
csum04929  GnRH secretion
csum04930  Type II diabetes mellitus
csum04933  AGE-RAGE signaling pathway in diabetic complications
csum04934  Cushing syndrome
csum04935  Growth hormone synthesis, secretion and action
csum04960  Aldosterone-regulated sodium reabsorption
csum05010  Alzheimer disease
csum05020  Prion disease
csum05022  Pathways of neurodegeneration - multiple diseases
csum05034  Alcoholism
csum05132  Salmonella infection
csum05133  Pertussis
csum05135  Yersinia infection
csum05140  Leishmaniasis
csum05142  Chagas disease
csum05145  Toxoplasmosis
csum05152  Tuberculosis
csum05160  Hepatitis C
csum05161  Hepatitis B
csum05163  Human cytomegalovirus infection
csum05164  Influenza A
csum05165  Human papillomavirus infection
csum05166  Human T-cell leukemia virus 1 infection
csum05167  Kaposi sarcoma-associated herpesvirus infection
csum05170  Human immunodeficiency virus 1 infection
csum05171  Coronavirus disease - COVID-19
csum05200  Pathways in cancer
csum05203  Viral carcinogenesis
csum05205  Proteoglycans in cancer
csum05206  MicroRNAs in cancer
csum05207  Chemical carcinogenesis - receptor activation
csum05208  Chemical carcinogenesis - reactive oxygen species
csum05210  Colorectal cancer
csum05211  Renal cell carcinoma
csum05212  Pancreatic cancer
csum05213  Endometrial cancer
csum05214  Glioma
csum05215  Prostate cancer
csum05216  Thyroid cancer
csum05218  Melanoma
csum05219  Bladder cancer
csum05220  Chronic myeloid leukemia
csum05221  Acute myeloid leukemia
csum05223  Non-small cell lung cancer
csum05224  Breast cancer
csum05225  Hepatocellular carcinoma
csum05226  Gastric cancer
csum05230  Central carbon metabolism in cancer
csum05231  Choline metabolism in cancer
csum05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
csum05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:csum00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    138075362 (MAPK3)
   04012 ErbB signaling pathway
    138075362 (MAPK3)
   04014 Ras signaling pathway
    138075362 (MAPK3)
   04015 Rap1 signaling pathway
    138075362 (MAPK3)
   04350 TGF-beta signaling pathway
    138075362 (MAPK3)
   04370 VEGF signaling pathway
    138075362 (MAPK3)
   04371 Apelin signaling pathway
    138075362 (MAPK3)
   04668 TNF signaling pathway
    138075362 (MAPK3)
   04066 HIF-1 signaling pathway
    138075362 (MAPK3)
   04068 FoxO signaling pathway
    138075362 (MAPK3)
   04072 Phospholipase D signaling pathway
    138075362 (MAPK3)
   04071 Sphingolipid signaling pathway
    138075362 (MAPK3)
   04024 cAMP signaling pathway
    138075362 (MAPK3)
   04022 cGMP-PKG signaling pathway
    138075362 (MAPK3)
   04151 PI3K-Akt signaling pathway
    138075362 (MAPK3)
   04150 mTOR signaling pathway
    138075362 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    138075362 (MAPK3)
   04148 Efferocytosis
    138075362 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    138075362 (MAPK3)
   04210 Apoptosis
    138075362 (MAPK3)
   04218 Cellular senescence
    138075362 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    138075362 (MAPK3)
   04520 Adherens junction
    138075362 (MAPK3)
   04540 Gap junction
    138075362 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    138075362 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    138075362 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    138075362 (MAPK3)
   04613 Neutrophil extracellular trap formation
    138075362 (MAPK3)
   04620 Toll-like receptor signaling pathway
    138075362 (MAPK3)
   04621 NOD-like receptor signaling pathway
    138075362 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    138075362 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    138075362 (MAPK3)
   04660 T cell receptor signaling pathway
    138075362 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    138075362 (MAPK3)
   04659 Th17 cell differentiation
    138075362 (MAPK3)
   04657 IL-17 signaling pathway
    138075362 (MAPK3)
   04662 B cell receptor signaling pathway
    138075362 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    138075362 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    138075362 (MAPK3)
   04062 Chemokine signaling pathway
    138075362 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    138075362 (MAPK3)
   04929 GnRH secretion
    138075362 (MAPK3)
   04912 GnRH signaling pathway
    138075362 (MAPK3)
   04915 Estrogen signaling pathway
    138075362 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    138075362 (MAPK3)
   04917 Prolactin signaling pathway
    138075362 (MAPK3)
   04921 Oxytocin signaling pathway
    138075362 (MAPK3)
   04926 Relaxin signaling pathway
    138075362 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    138075362 (MAPK3)
   04919 Thyroid hormone signaling pathway
    138075362 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    138075362 (MAPK3)
   04916 Melanogenesis
    138075362 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    138075362 (MAPK3)
   04270 Vascular smooth muscle contraction
    138075362 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    138075362 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    138075362 (MAPK3)
   04725 Cholinergic synapse
    138075362 (MAPK3)
   04726 Serotonergic synapse
    138075362 (MAPK3)
   04720 Long-term potentiation
    138075362 (MAPK3)
   04730 Long-term depression
    138075362 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    138075362 (MAPK3)
   04722 Neurotrophin signaling pathway
    138075362 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    138075362 (MAPK3)
   04380 Osteoclast differentiation
    138075362 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    138075362 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    138075362 (MAPK3)
   05206 MicroRNAs in cancer
    138075362 (MAPK3)
   05205 Proteoglycans in cancer
    138075362 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    138075362 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    138075362 (MAPK3)
   05203 Viral carcinogenesis
    138075362 (MAPK3)
   05230 Central carbon metabolism in cancer
    138075362 (MAPK3)
   05231 Choline metabolism in cancer
    138075362 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    138075362 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    138075362 (MAPK3)
   05212 Pancreatic cancer
    138075362 (MAPK3)
   05225 Hepatocellular carcinoma
    138075362 (MAPK3)
   05226 Gastric cancer
    138075362 (MAPK3)
   05214 Glioma
    138075362 (MAPK3)
   05216 Thyroid cancer
    138075362 (MAPK3)
   05221 Acute myeloid leukemia
    138075362 (MAPK3)
   05220 Chronic myeloid leukemia
    138075362 (MAPK3)
   05218 Melanoma
    138075362 (MAPK3)
   05211 Renal cell carcinoma
    138075362 (MAPK3)
   05219 Bladder cancer
    138075362 (MAPK3)
   05215 Prostate cancer
    138075362 (MAPK3)
   05213 Endometrial cancer
    138075362 (MAPK3)
   05224 Breast cancer
    138075362 (MAPK3)
   05223 Non-small cell lung cancer
    138075362 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    138075362 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    138075362 (MAPK3)
   05161 Hepatitis B
    138075362 (MAPK3)
   05160 Hepatitis C
    138075362 (MAPK3)
   05171 Coronavirus disease - COVID-19
    138075362 (MAPK3)
   05164 Influenza A
    138075362 (MAPK3)
   05163 Human cytomegalovirus infection
    138075362 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    138075362 (MAPK3)
   05165 Human papillomavirus infection
    138075362 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    138075362 (MAPK3)
   05135 Yersinia infection
    138075362 (MAPK3)
   05133 Pertussis
    138075362 (MAPK3)
   05152 Tuberculosis
    138075362 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    138075362 (MAPK3)
   05140 Leishmaniasis
    138075362 (MAPK3)
   05142 Chagas disease
    138075362 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    138075362 (MAPK3)
   05020 Prion disease
    138075362 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    138075362 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    138075362 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    138075362 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    138075362 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    138075362 (MAPK3)
   04934 Cushing syndrome
    138075362 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    138075362 (MAPK3)
   01524 Platinum drug resistance
    138075362 (MAPK3)
   01522 Endocrine resistance
    138075362 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:csum01001]
    138075362 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:csum03036]
    138075362 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:csum04147]
    138075362 (MAPK3)
Enzymes [BR:csum01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     138075362 (MAPK3)
Protein kinases [BR:csum01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   138075362 (MAPK3)
Chromosome and associated proteins [BR:csum03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     138075362 (MAPK3)
Exosome [BR:csum04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   138075362 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 138075362
NCBI-ProteinID: XP_068823170
LinkDB
Position
3:complement(15922523..15929232)
AA seq 380 aa
MAAAAAAQGGGGGEPRGTDGVGPGVPGEVEIVKGQPFDVGPRYTQLQYIGEGAYGMVSSA
YDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDVY
IVQDLMETDLYKLLKSQQLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCD
LKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEML
SNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKS
DPKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKER
LKELIFQETARFQPGVLEAS
NT seq 1143 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggctcaggggggcgggggcggggagccccggggaactgatggg
gtcggcccgggggtcccgggggaggtggagatagtaaaggggcagccgttcgacgtgggc
ccgcgctacacgcagctgcagtacatcggcgagggcgcgtacggcatggtcagctcagct
tacgaccatgtgcgcaagactcgagtggccatcaagaagatcagcccctttgagcatcag
acctactgccagcgcacgttgcgagagattcagattctgctgcgcttccgccatgagaac
gtcattggcatccgagacattctgcgagcacccaccctggaagccatgagggatgtctac
atcgtgcaggacctgatggagacagacctgtacaaattgctcaaaagccagcagctgagc
aacgaccacgtatgctacttcctgtaccagatcctgcggggcctgaagtatatccactcc
gccaacgtgctccaccgggatttaaagccctccaacctgctcatcaacaccacctgcgac
cttaagatctgtgatttcggtcttgcccggattgctgatcccgagcacgaccacactggc
ttcttgacggaatacgtggccacacgctggtaccgggccccagagatcatgcttaactcc
aagggctacaccaagtccatcgacatctggtctgtgggctgcattctggctgagatgctc
tccaaccggcccatcttccccggcaagcactacctggaccagctcaaccacattctgggt
attctgggctccccatcccaggaggacctgaactgtatcatcaacatgaaagcccgaaac
tacctgcagtctctgccctccaagaccaaggtggcctgggccaagctttttcctaagtca
gaccccaaagctcttgacctgctggaccggatgttgacctttaaccccaacaaacggatc
acagtggaagaagcgctggctcacccctacctggagcagtactatgacccaacggatgag
ccagtggccgaggaacctttcaccttcgacatggagctggatgatctacccaaggaacga
ctgaaggagctcatcttccaggagacagcccgcttccagcctggggtgctggaggcctcc
taa

DBGET integrated database retrieval system