Chryseobacterium suipulveris: MTP09_05340 Help Entry MTP09_05340       CDS       T08539                                  Symbol atpE Name (GenBank) ATP synthase F0 subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism csup  Chryseobacterium suipulveris Pathway csup00190   Oxidative phosphorylation csup01100   Metabolic pathways Module csup_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:csup00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     MTP09_05340 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:csup00194]     MTP09_05340 (atpE) Photosynthesis proteins [BR:csup00194]  Photosystem and electron transport system   F-type ATPase [OT]    MTP09_05340 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  UOE42060 LinkDB All DBs Position 1146188..1146382 Genome browser AA seq 64 aa AA seqDB search MEMPKIIGAGLVVIGTGIGIGKIGAAALEGMARQPEQAGKLQTAMLIAAALVEGVAFAAL FAVN NT seq 195 nt NT seq  +upstreamnt  +downstreamnt atggaaatgccaaaaatcattggtgcaggtttagttgtaatcggaacaggtatcggtatc ggtaagatcggtgctgctgctttggaaggtatggctagacaaccagaacaagctggtaaa cttcagactgcgatgttgatcgctgcagctcttgtagaaggggttgcgttcgctgcattg ttcgcagtaaactaa

DBGET integrated database retrieval system