Corynebacterium suranareeae: N24_2316 Help Entry N24_2316          CDS       T07007                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism csur  Corynebacterium suranareeae Pathway csur00998   Biosynthesis of various antibiotics csur01100   Metabolic pathways csur01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:csur00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     N24_2316    00074 Mycolic acid biosynthesis     N24_2316   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     N24_2316 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  BAU96578 UniProt:  A0A169S0Y7 LinkDB All DBs Position 2525498..2525767 Genome browser AA seq 89 aa AA seqDB search MDLNDLNTTEAPNVFSQLAQILQNVDGVAAESVSPESRFVDDLAISSLNYIELIVNVEDA FGVRIEDADAKDFTTVQDLIDFINTNKVD NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atggatttaaacgacctgaacactactgaagccccaaatgttttttctcaactggctcaa attttgcagaatgtagatggcgtagctgcagaaagtgtttcaccagagtcccgctttgtt gatgatctagcgataagttcacttaattacatcgaattaattgtcaacgtagaagatgcc tttggtgttcgcattgaagatgccgatgccaaagatttcaccaccgtgcaggatctgatt gattttattaacacaaacaaggttgattag

DBGET integrated database retrieval system