KEGG   Chromobacterium subtsugae: U6115_10130
Entry
U6115_10130       CDS       T11179                                 
Symbol
tauD
Name
(GenBank) taurine dioxygenase
  KO
K03119  taurine dioxygenase [EC:1.14.11.17]
Organism
csut  Chromobacterium subtsugae
Pathway
csut00430  Taurine and hypotaurine metabolism
csut00920  Sulfur metabolism
Brite
KEGG Orthology (KO) [BR:csut00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    U6115_10130 (tauD)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    U6115_10130 (tauD)
Enzymes [BR:csut01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.17  taurine dioxygenase
     U6115_10130 (tauD)
SSDB
Motif
Pfam: TauD
Other DBs
NCBI-ProteinID: WSE93568
LinkDB
Position
2039900..2040733
AA seq 277 aa
MSLQLTRLSPALGAVVEGIDLARPLDDEQRRAVNEALLRYQVLFFRGQDITPLQQRNFAV
RFGDLHTHPIYPQHPEAREIMVLDTDVVDLQDNAIWHTDVTFIETPPLGGVLAARELPEL
GGDTLWASGIAAYEALSASLKARLEGLSAVHDFAKSFPLARYGVTDEDRRRWDETRRKHP
PISHPLVRIHPESGRRALFVSEGFTVAVNDLPEAEGQALLQFLFAHQSKPEFSIRWRWQP
GDVAFWDNRCTIHYAVDDYRPARRVMHRATILGDRPY
NT seq 834 nt   +upstreamnt  +downstreamnt
atgagtttgcaattgacccgcctgagcccggcgctgggcgcggtggtggaggggatagac
ctggcgcggccgttggacgacgagcagcgtcgggcagtgaacgaggcgctgctgcgctac
caggtgctgtttttccgcggccaggacatcaccccgctgcagcagcgcaatttcgcggtg
cgcttcggcgacctgcacacccacccgatctatccgcagcacccggaggcgcgcgagatc
atggtgttggacaccgatgtggtggatttgcaggacaacgcgatctggcacaccgacgtc
accttcatcgaaaccccgccgctgggcggagtgctggcggcgcgcgagctgccggagctg
ggcggcgacacgctgtgggccagcggcatcgccgcctacgaagcgttgtcggccagcctg
aaggccaggctggaaggcctgagcgcggtgcatgatttcgccaaatccttcccgctggcg
cgctacggcgtcaccgacgaagaccgccgccgctgggacgagacgcggcgcaagcatccg
ccgatcagccacccgctggtgcgcatccacccggaaagcggccgccgggcgctgttcgtc
agcgagggcttcaccgtcgcggtcaacgatctgccggaagccgagggccaggccttgctg
cagttcctgttcgcccaccagtccaagccggagttttcgatacgctggcgctggcagccg
ggcgacgtggcgttctgggacaaccgctgcaccatccactacgcggtggacgactaccgg
ccggcgcggcgggtgatgcaccgggcgacgatactgggcgaccggccgtactaa

DBGET integrated database retrieval system