Chromobacterium subtsugae: U6115_12270 Help Entry U6115_12270       CDS       T11179                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism csut  Chromobacterium subtsugae Pathway csut00998   Biosynthesis of various antibiotics csut01100   Metabolic pathways csut01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:csut00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     U6115_12270    00074 Mycolic acid biosynthesis     U6115_12270   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     U6115_12270 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  WSE89664 LinkDB All DBs Position complement(2539348..2539599) Genome browser AA seq 83 aa AA seqDB search MTKDELFARLSAVLQDTFEIEADAIHPEARLREDLDIDSIDAVDLIVQFRPLVGKRLQPD VFKSVRTLQDVVDALHGLMQEND NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgaccaaagacgaactcttcgcgcgcctgagcgctgtgctgcaggacacttttgaaatc gaagccgacgccatccacccggaagcgcgcctgcgcgaagacctggacatcgacagcatc gacgccgtggacctgatcgtccagttccgtccgctggtgggcaaacgcctgcagccggac gtgttcaagtcggtgcgcacgctgcaagacgtagtggacgccctccacggcctgatgcag gaaaacgactga

DBGET integrated database retrieval system