Chromobacterium subtsugae: U6115_13090 Help Entry U6115_13090       CDS       T11179                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism csut  Chromobacterium subtsugae Pathway csut00998   Biosynthesis of various antibiotics csut01100   Metabolic pathways csut01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:csut00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     U6115_13090    00074 Mycolic acid biosynthesis     U6115_13090   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     U6115_13090 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding KMPT-N Motif Other DBs NCBI-ProteinID:  WSE89823 LinkDB All DBs Position complement(2729592..2729831) Genome browser AA seq 79 aa AA seqDB search MPRAIEARVLAVLGASLGADLDRIQPASRLVDDLCADSLELLDMVMMLNDEFGIEIGVED IVGIRTVADVEAAVARRLA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt gtgccgcgcgcgattgaggccagggtgctggcggtgctgggcgccagcttgggcgcggat ttggaccggatccagcccgcgtcgcggctggtggacgatttgtgcgccgattcgctggag ctgctcgacatggtgatgatgctgaacgacgagttcggcatcgagatcggcgtcgaggac atcgtcggcatccgcaccgtcgccgatgtcgaggccgcggtggcgcgccgcctagcctag

DBGET integrated database retrieval system