KEGG   Chromobacterium subtsugae: U6115_17580
Entry
U6115_17580       CDS       T11179                                 
Symbol
truB
Name
(GenBank) tRNA pseudouridine(55) synthase TruB
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
csut  Chromobacterium subtsugae
Brite
KEGG Orthology (KO) [BR:csut00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:csut03016]
    U6115_17580 (truB)
Enzymes [BR:csut01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     U6115_17580 (truB)
Transfer RNA biogenesis [BR:csut03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    U6115_17580 (truB)
 Prokaryotic type
    U6115_17580 (truB)
SSDB
Motif
Pfam: TruB_N TruB-C_2 TruB_C_2
Other DBs
NCBI-ProteinID: WSE90686
LinkDB
Position
complement(3702097..3703020)
AA seq 307 aa
MSKPRSTKRQIDGVLLIDKPYDISSNNALQKARWLLNAAKAGHTGVLDPLATGLLPVCLG
EATKFSSYLLDADKGYRATVKFGAVTTTGDVEGEVVSERPVSFSREQLEAALASFRGEIS
QVPPMYSALKHQGKPLYEYARAGIEVPREARRVTIRKLELLAFDGVSAEIDVLCTKGTYI
RTLACDIGEALGSGAHLTALRRTATGGFGLDEAHTLAALEALEMAGREALLLPVDVLVQH
FPETELADGEIGKFMNGQAVLFAEKCEKMQRFRVYQKSTRRFMGLGEARDDGRLHPIRLL
ANQAATS
NT seq 924 nt   +upstreamnt  +downstreamnt
atgagcaagccgcgcagcaccaagcgccagatcgacggcgtgctgctgatagacaagcct
tacgacatctccagcaacaacgcgctgcaaaaggcgcgctggctgctgaacgccgccaag
gccggccataccggcgtgctggacccgctggccaccgggctgctgccggtgtgcctgggc
gaggccaccaagttttcctcgtatctgctggacgccgacaagggctaccgcgccacggtg
aaattcggcgcggtgacgacgacgggcgatgtcgagggcgaagtggtgtccgagcggccg
gtcagcttcagccgcgaacagctggaagccgcgctggcgtcgttccgcggcgaaatcagc
caggtgccgccgatgtattcggcgctgaaacaccagggcaagccgctgtacgaatacgcg
cgcgccggcatcgaagtgccgcgcgaggcgcgccgggtgaccatccgcaagctggagctg
ctggccttcgacggcgtgtctgccgaaatcgacgtgctgtgcaccaagggcacctatatc
cgcaccctggcttgcgacatcggcgaagccttgggcagcggcgcgcatttgaccgcgctg
cgccgcaccgccaccggcggcttcggcctggacgaagcgcacacgctggcggcgctggag
gcgctggagatggccgggcgcgaagccttgctgctgccggtcgacgtgctggtgcaacat
tttccggaaaccgagctggccgacggcgaaatcggcaagttcatgaacggacaagccgtg
ctttttgctgaaaagtgtgagaaaatgcagcgcttccgggtataccaaaagtctacccgg
cgcttcatggggctgggcgaggcgcgcgacgatggtcgcctgcatccgatccggctcctg
gccaaccaggcggcaacgtcctga

DBGET integrated database retrieval system