Cucumis sativus (cucumber): 101214589 Help Entry 101214589         CDS       T02486                                  Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism csv  Cucumis sativus (cucumber) Pathway csv04136   Autophagy - other Brite KEGG Orthology (KO) [BR:csv00001]  09140 Cellular Processes   09141 Transport and catabolism    04136 Autophagy - other     101214589  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:csv04131]     101214589    04121 Ubiquitin system [BR:csv04121]     101214589    03029 Mitochondrial biogenesis [BR:csv03029]     101214589 Membrane trafficking [BR:csv04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     101214589 Ubiquitin system [BR:csv04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    101214589 Mitochondrial biogenesis [BR:csv03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     101214589 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 ATG8 Motif Other DBs NCBI-GeneID:  101214589 NCBI-ProteinID:  XP_004151012 UniProt:  A0A0A0LIA6 LinkDB All DBs Position 3:complement(35358569..35361009) Genome browser AA seq 95 aa AA seqDB search MTSTESSSSARKVVVLLRATGDAPILKQTKFKMPGTDKFIKVIDYIRRSIQRDTLFVFVN SAFSPGPDETVIDLYNNFGIDGKLVVNYACSMAWG NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgacttctacagagtcatccagttctgctcgaaaagtggttgtcctgttgagagctact ggggatgctcccattctcaaacaaactaagtttaagatgcccggaacagacaaatttatt aaagtgattgattatatacgccggtccattcaacgggacaccttgtttgtgtttgtcaac agtgcattctcaccgggtccagatgagacagttattgatctatataataactttggaatt gatgggaagttggtggtaaattatgcctgctccatggcttggggctaa

DBGET integrated database retrieval system