Cucumis sativus (cucumber): 101215461 Help Entry 101215461         CDS       T02486                                  Name (RefSeq) LOW QUALITY PROTEIN: elongin-C   KO K03872   elongin-C Organism csv  Cucumis sativus (cucumber) Pathway csv04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:csv00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     101215461  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:csv04121]     101215461    03400 DNA repair and recombination proteins [BR:csv03400]     101215461 Ubiquitin system [BR:csv04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      101215461    Cul5 complex      101215461 DNA repair and recombination proteins [BR:csv03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      101215461 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ YozE_SAM_like Motif Other DBs NCBI-GeneID:  101215461 NCBI-ProteinID:  XP_031741205 LinkDB All DBs Position 1:21722444..21724689 Genome browser AA seq 98 aa AA seqDB search MKKEDTVKLISAEGFEFVIHKDAAMVSQTIRNMLTSPGNFAESQHREVTFPEISTTILEK ICQYFHWNLPFVSGKETEFPIEPELTLELMMAANYLHT NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgaagaaggaagacactgtaaaattgatcagcgctgaaggtttcgagttcgtgattcac aaggatgctgccatggtttctcaaacgattcgaaacatgcttacttccccaggaaatttt gctgaatcgcagcatagagaagtgacttttcctgagattagtaccaccattctcgagaag atttgccaatattttcactggaatcttccttttgtcagtgggaaagagaccgagttccct attgaacctgaattgactcttgagttgatgatggctgccaactatctccatacatga

DBGET integrated database retrieval system