KEGG   Cucumis sativus (cucumber): 101221119
Entry
101221119         CDS       T02486                                 
Name
(RefSeq) mitochondrial import inner membrane translocase subunit TIM17-2
  KO
K17795  mitochondrial import inner membrane translocase subunit TIM17
Organism
csv  Cucumis sativus (cucumber)
Brite
KEGG Orthology (KO) [BR:csv00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:csv03029]
    101221119
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:csv02000]
    101221119
Mitochondrial biogenesis [BR:csv03029]
 Mitochondrial protein import machinery
  Inner mambrane
   TIM23 complex
    101221119
Transporters [BR:csv02000]
 Other transporters
  Primary active transporters [TC:3]
   101221119
SSDB
Motif
Pfam: Tim17
Other DBs
NCBI-GeneID: 101221119
NCBI-ProteinID: XP_004135673
UniProt: A0A0A0LWN7
LinkDB
Position
1:25189714..25190704
AA seq 226 aa
MGTPETSREPCPDRILDDIGGAFGMGAVGGSAFHFLKGIYSSPKGSRLLGGSQAVRMNAP
RIGGSFAVWGGLFSTFDCSMVYLRQKEDPWNSIIAGAATGGFLQMRQGVGASARSALFGG
VLLALIEGAGIMLNKVLSQPQNAPIMIDDAGAMAGVPGYPMDQIPGLTPPGTSSGSPGSS
DAGSGSWFGGLFGGGQKKDSEANRGDGETKILESFDSPPVPNFEFK
NT seq 681 nt   +upstreamnt  +downstreamnt
atgggaacgcctgagacttctcgagagccttgtccagatcggatcctcgacgacattggt
ggcgctttcggtatgggcgctgtcggtggctccgccttccattttctcaaaggcatctac
agttctcctaaaggctctcgtcttcttggtggttctcaagccgtccgaatgaacgctcct
cgtattggcggtagctttgccgtttggggtggcttgttctccacttttgattgctccatg
gtctacctccgtcagaaggaagatccatggaactcgatcatagccggtgctgctactggc
ggcttcctccagatgcgtcagggcgtcggcgcttccgcccgttcggctttgtttggcggt
gttttgctggctttgatcgagggagccgggatcatgcttaataaggttcttagtcaaccg
cagaacgctcctattatgatcgacgatgccggtgctatggcaggcgtccctggttatcct
atggatcagattccgggactaacgccaccgggaacttcgtcgggaagtccgggatcttca
gatgcaggttcagggtcatggttcggaggattgtttggtgggggacagaaaaaggattca
gaggcaaatcgtggggacggggaaacgaagattttggagagctttgattcaccgccggtg
ccaaatttcgagttcaagtaa

DBGET integrated database retrieval system