Cenarchaeum symbiosum: CENSYa_0108 Help Entry CENSYa_0108       CDS       T01380                                  Name (GenBank) ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism csy  Cenarchaeum symbiosum Pathway csy03010   Ribosome Brite KEGG Orthology (KO) [BR:csy00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     CENSYa_0108   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     CENSYa_0108  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:csy03011]     CENSYa_0108    04121 Ubiquitin system [BR:csy04121]     CENSYa_0108 Ribosome [BR:csy03011]  Ribosomal proteins   Eukaryotes    Large subunit     CENSYa_0108   Archaea     CENSYa_0108 Ubiquitin system [BR:csy04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    CENSYa_0108 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_L40e DZR Zn_Ribbon_1 DZR_2 DUF7577 zf-tcix Zn_ribbon_3 Motif Other DBs NCBI-ProteinID:  ABK76753 UniProt:  A0RTT6 LinkDB All DBs Position complement(83933..84100) Genome browser AA seq 55 aa AA seqDB search MPITDVAKRQIAQKARLHMKICFYCGARNSMAATRCRKCRNNYLRLKNRNLGAKK NT seq 168 nt NT seq  +upstreamnt  +downstreamnt atgccgataacggacgtggcgaaaaggcagatagcccaaaaggcccgcctccacatgaag atctgcttttactgcggggcgagaaactcgatggccgccacccggtgcagaaagtgcagg aacaactatctccgtctaaagaaccgcaacctgggcgcgaaaaagtag

DBGET integrated database retrieval system